PTH Protein, Human, Recombinant (Active)

Name: PTH Protein, Human, Recombinant (Active)
Brand: TargetMol
SKU: TMPH-04051
Price: 72 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: PTH, Parathyroid hormone, Parathyrin, Parathormone) Copy Product Info

Synonyms: PTH, Parathyroid hormone, Parathyrin, Parathormone

Catalog No. TMPH-04051 Copy Product Info

PTH Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P01270.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$72	-	In Stock
10 µg	$108	-	In Stock
20 µg	$186	-	In Stock
50 µg	$365	7-10 days	7-10 days
100 µg	$613	7-10 days	7-10 days
200 µg	$857	7-10 days	7-10 days
500 µg	$1,330	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:> 97 % by SDS-PAGE and HPLC analyses.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of ＞ 2.0 × 104 IU/mg.
Description	PTH Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P01270.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P01270
Amino Acid	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Construction	32-115 aa
Protein Purity	>97% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	PTH, Parathyroid hormone, Parathyrin, Parathormone

Chemical Properties

Molecular Weight

9.4 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.