Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: PTH, Parathyroid hormone, Parathyrin, Parathormone


| Pack Size | Price | EUR Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | 64 € | - | In Stock | |
| 10 µg | 97 € | - | In Stock | |
| 20 µg | 167 € | - | In Stock | |
| 50 µg | 328 € | 7-10 days | 7-10 days | |
| 100 µg | 551 € | 7-10 days | 7-10 days | |
| 200 µg | 771 € | 7-10 days | 7-10 days | |
| 500 µg | 1.197 € | 7-10 days | 7-10 days |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg. |
| Description | PTH Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P01270. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P01270 |
| Amino Acid | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
| Construction | 32-115 aa |
| Protein Purity | >97% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | PTH, Parathyroid hormone, Parathyrin, Parathormone |
| Molecular Weight | 9.4 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.