Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

PTH Protein, Human, Recombinant (Active)

TargetMol | SPR
Catalog No. TMPH-04051

PTH Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P01270.

PTH Protein, Human, Recombinant (Active)

PTH Protein, Human, Recombinant (Active)

TargetMol | SPR
Catalog No. TMPH-04051
PTH Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P01270.
Pack SizePriceAvailabilityQuantity
5 μg$6420 days
10 μg$9820 days
20 μg$16520 days
50 μg$32320 days
100 μg$54320 days
200 μg$75820 days
500 μg$1,18020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg.
Description
PTH Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P01270.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP01270
Synonyms
PTH,Parathyroid hormone,Parathyrin,Parathormone
Amino Acid
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Construction
32-115 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight9.4 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.