Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

PTH Protein, Human, Recombinant (Active)

TargetMol | SPR
Catalog No. TMPH-04051 Copy Product Info
PTH Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P01270.

PTH Protein, Human, Recombinant (Active)

Catalog No. TMPH-04051
Copy Product Info
TargetMol | SPR

PTH Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P01270.

PTH Protein, Human, Recombinant (Active)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$72-In Stock
10 μg$108-In Stock
20 μg$186-In Stock
50 μg$3657-10 days7-10 days
100 μg$6137-10 days7-10 days
200 μg$8577-10 days7-10 days
500 μg$1,3307-10 days7-10 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg.
Description
PTH Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P01270.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP01270
Synonyms
PTH,Parathyroid hormone,Parathyrin,Parathormone
Amino Acid
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Construction
32-115 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight9.4 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.