PRDX1 Protein, Human, Recombinant (His)

Name: PRDX1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04588
Price: 116 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Thioredoxin-dependent peroxiredoxin 1, Thioredoxin-dependent peroxide reductase 2, Thioredoxin peroxidase 2, TDPX2, Proliferation-associated gene protein (PAG), PRDX1, Peroxiredoxin-1, PAGB, PAGA, Natural killer cell-enhancing factor A (NKEF-A)) Copy Product Info

Synonyms: Thioredoxin-dependent peroxiredoxin 1, Thioredoxin-dependent peroxide reductase 2, Thioredoxin peroxidase 2, TDPX2, Proliferation-associated gene protein (PAG), PRDX1, Peroxiredoxin-1, PAGB, PAGA, Natural killer cell-enhancing factor A (NKEF-A)

Catalog No. TMPH-04588 Copy Product Info

PRDX1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q06830.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$116	-	In Stock
10 µg	$189	-	In Stock
20 µg	$317	12 days	12 days
50 µg	$448	12 days	12 days
100 µg	$588	12 days	12 days
200 µg	$913	12 days	12 days
500 µg	$1,630	12 days	12 days
1 mg	$2,550	12 days	12 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:98% (SDS-PAGE)

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PRDX1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q06830.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q06830
Amino Acid	MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Construction	1-199 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Thioredoxin-dependent peroxiredoxin 1, Thioredoxin-dependent peroxide reductase 2, Thioredoxin peroxidase 2, TDPX2, Proliferation-associated gene protein (PAG), PRDX1, Peroxiredoxin-1, PAGB, PAGA, Natural killer cell-enhancing factor A (NKEF-A)

Chemical Properties

Molecular Weight

29.0 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 225 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.