Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

PLA2R1 Protein, Human, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02071 Copy Product Info
PLA2R1 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

PLA2R1 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-02071
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

PLA2R1 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

PLA2R1 Protein, Human, Recombinant (His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10820 days20 days
10 μg$17720 days20 days
20 μg$29320 days20 days
50 μg$54920 days20 days
100 μg$89020 days20 days
200 μg$98720 days20 days
500 μg$1,29020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
PLA2R1 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.
Species
Human
Expression System
Baculovirus Insect Cells
TagN-10xHis, C-Myc
Accession NumberQ13018
Synonyms
Secretory phospholipase A2 receptor,PLA2R1,PLA2-R,PLA2R,M-type receptor,C-type lectin domain family 13 member C,CLEC13C,180 kDa secretory phospholipase A2 receptor
Amino Acid
EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Construction
395-530 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight19.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phospholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of extracellular sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B. In podocytes, binding of sPLA2-IB/PLA2G1B can regulate podocyte survival and glomerular homeostasis.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords