Shopping Cart
Remove All
Your shopping cart is currently empty
PLA2G15 Protein, Human, Recombinant (His)
(Synonyms: PLA2G15, Lysosomal phospholipase A2, Lysosomal phospholipase A and acyltransferase, Lysophospholipase 3, LYPLA3, LPLA2) Copy Product InfoSynonyms: PLA2G15, Lysosomal phospholipase A2, Lysosomal phospholipase A and acyltransferase, Lysophospholipase 3, LYPLA3, LPLA2
Catalog No. TMPH-04817 Copy Product Info
PLA2G15 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8NCC3.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $100 | - | In Stock | |
| 10 μg | $161 | - | In Stock | |
| 20 μg | $256 | 20 days | 20 days | |
| 50 μg | $383 | 20 days | 20 days | |
| 100 μg | $480 | 20 days | 20 days | |
| 1 mg | $2,060 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:90% (SDS-PAGE)
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | PLA2G15 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8NCC3. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | Q8NCC3 |
| Amino Acid | AGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP |
| Construction | 34-412 aa |
| Protein Purity | >90% as determined by SDS-PAGE. https://cdn.targetmol.com/group3/M00/5E/EE/CgoaEWmeVL-EaxMxAAAAAI-J4JQ233.png |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris/PBS-based buffer |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | PLA2G15, Lysosomal phospholipase A2, Lysosomal phospholipase A and acyltransferase, Lysophospholipase 3, LYPLA3, LPLA2 |
| Molecular Weight | 49.9 kDa (Predicted) |
| Relative Density. | no data available |
| Storage | Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: PLA2G15 Protein, Human, Recombinant (His) chemical structure | PLA2G15 Protein, Human, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.