PLA2G15 Protein, Human, Recombinant (His)

Catalog No. TMPH-04817 Copy Product Info

PLA2G15 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8NCC3.

PLA2G15 Protein, Human, Recombinant (His)

Catalog No. TMPH-04817

Copy Product Info

PLA2G15 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8NCC3.

Pack Size	Price	USA Stock	Global Stock
5 μg	$100	-	In Stock
10 μg	$161	-	In Stock
20 μg	$256	20 days	20 days
50 μg	$383	20 days	20 days
100 μg	$480	20 days	20 days
1 mg	$2,060	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	PLA2G15 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8NCC3.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q8NCC3
Synonyms	PLA2G15,Lysosomal phospholipase A2,Lysosomal phospholipase A and acyltransferase,Lysophospholipase 3,LYPLA3,LPLA2
Amino Acid	AGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Construction	34-412 aa
Protein Purity	>90% as determined by SDS-PAGE.
Molecular Weight	49.9 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris/PBS-based buffer
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.