Shopping Cart
Remove All
Your shopping cart is currently empty
Phospholipase A2 Protein, Crotalus atrox, Recombinant (His & Myc) is expressed in Baculovirus.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $176 | 20 days | 20 days | |
| 10 μg | $293 | 20 days | 20 days | |
| 20 μg | $491 | 20 days | 20 days | |
| 50 μg | $926 | 20 days | 20 days | |
| 100 μg | $1,500 | 20 days | 20 days | |
| 200 μg | $1,830 | 20 days | 20 days | |
| 500 μg | $2,390 | 20 days | 20 days | |
| 1 mg | $2,960 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Phospholipase A2 Protein, Crotalus atrox, Recombinant (His & Myc) is expressed in Baculovirus. |
| Species | Crotalus atrox |
| Expression System | Baculovirus Insect Cells |
| Tag | N-10xHis, C-Myc |
| Accession Number | P0CV89 |
| Synonyms | svPLA2,Phospholipase A2,Phosphatidylcholine 2-acylhydrolase |
| Amino Acid | NLLQFNKMIKIMTKKNAFPFYTSYGCYCGWGGRCCFVHDCCYEKTDIYSYSWKRQICECDR |
| Construction | 1-61 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 11.2 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Snake venom phospholipase A2 (PLA2) that displays edema-inducing activities. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.