Papain Protein, Carica papaya, Recombinant (His)

Name: Papain Protein, Carica papaya, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00347
Rating: 4.5 (1 reviews)

(Synonyms: Papaya proteinase I (PPI), Papain) Copy Product Info

Synonyms: Papaya proteinase I (PPI), Papain

Catalog No. TMPH-00347 Copy Product Info

Papain Protein, Carica papaya, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is P00784.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$187	20 days	20 days
10 µg	$297	20 days	20 days
20 µg	$521	20 days	20 days
50 µg	$788	20 days	20 days
100 µg	$1,080	20 days	20 days
200 µg	$1,550	20 days	20 days
500 µg	$2,530	20 days	20 days
1 mg	$3,660	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Papain Protein, Carica papaya, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is P00784.
Species	Carica papaya
Expression System	E. coli
Tag	N-6xHis
Accession Number	P00784
Amino Acid	IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Construction	134-345 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Papaya proteinase I (PPI), Papain

Chemical Properties

Molecular Weight

27.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.