Papain Protein, Carica papaya, Recombinant (His)

Catalog No. TMPH-00347 Copy Product Info

Papain Protein, Carica papaya, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is P00784.

Papain Protein, Carica papaya, Recombinant (His)

Catalog No. TMPH-00347

Copy Product Info

Papain Protein, Carica papaya, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is P00784.

Pack Size	Price	USA Stock	Global Stock
5 μg	$187	20 days	20 days
10 μg	$297	20 days	20 days
20 μg	$521	20 days	20 days
50 μg	$788	20 days	20 days
100 μg	$1,080	20 days	20 days
200 μg	$1,550	20 days	20 days
500 μg	$2,530	20 days	20 days
1 mg	$3,660	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Papain Protein, Carica papaya, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is P00784.
Species	Carica papaya
Expression System	E. coli
Tag	N-6xHis
Accession Number	P00784
Synonyms	Papaya proteinase I (PPI),Papain
Amino Acid	IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Construction	134-345 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	27.4 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.