Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Papain Protein, Carica papaya, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00347

Papain Protein, Carica papaya, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is P00784.

Papain Protein, Carica papaya, Recombinant (His)

Papain Protein, Carica papaya, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00347
Papain Protein, Carica papaya, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is P00784.
Pack SizePriceAvailabilityQuantity
5 μg$18720 days
10 μg$29720 days
20 μg$52120 days
50 μg$78820 days
100 μg$1,08020 days
200 μg$1,55020 days
500 μg$2,53020 days
1 mg$3,66020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Papain Protein, Carica papaya, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is P00784.
Species
Carica papaya
Expression System
E. coli
TagN-6xHis
Accession NumberP00784
Synonyms
Papaya proteinase I (PPI),Papain
Amino Acid
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Construction
134-345 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Papain Protein, Carica papaya, Recombinant (His)
Molecular Weight27.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords