Oxalate oxidase 1 Protein, Hordeum vulgare, Recombinant (His & Myc)

Name: Oxalate oxidase 1 Protein, Hordeum vulgare, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-00824
Rating: 4.5 (1 reviews)

(Synonyms: Oxalate oxidase 1, Germin) Copy Product Info

Synonyms: Oxalate oxidase 1, Germin

Catalog No. TMPH-00824 Copy Product Info

Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms. Oxalate oxidase 1 Protein, Hordeum vulgare, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.2 kDa and the accession number is P45850.

Oxalate oxidase 1 Protein, Hordeum vulgare, Recombinant (His & Myc)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms. Oxalate oxidase 1 Protein, Hordeum vulgare, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.2 kDa and the accession number is P45850.
Species	Hordeum vulgare
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P45850
Amino Acid	SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Construction	1-201 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Oxalate oxidase 1, Germin
Research Background	Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms.

Chemical Properties

Molecular Weight

28.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

Oxalate oxidase1

Related Tags: Oxalate oxidase 1 Protein, Hordeum vulgare, Recombinant (His & Myc) chemical structure | Oxalate oxidase 1 Protein, Hordeum vulgare, Recombinant (His & Myc) molecular weight