Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

OX1R Protein, Human, Recombinant (His & SUMOstar)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01816

Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613.

OX1R Protein, Human, Recombinant (His & SUMOstar)

OX1R Protein, Human, Recombinant (His & SUMOstar)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01816
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12520 days20 days
10 μg$19820 days20 days
20 μg$34120 days20 days
50 μg$49720 days20 days
100 μg$69620 days20 days
200 μg$1,08020 days20 days
500 μg$1,95020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis-SUMOstar
Accession NumberO43613
Synonyms
Orexin/Hypocretin receptor type 1,Orexin receptor type 1 (Ox-1-R;Ox1-R;Ox1R),Hypocretin receptor type 1,HCRTR1
Amino Acid
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE
Construction
1-46 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight21.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords