Shopping Cart
Remove All
Your shopping cart is currently empty
OX1R Protein, Human, Recombinant (His & SUMOstar)
Catalog No. TMPH-01816 Copy Product Info
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613.
OX1R Protein, Human, Recombinant (His & SUMOstar)
Catalog No. TMPH-01816
Copy Product InfoModerately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $125 | 20 days | 20 days | |
| 10 μg | $198 | 20 days | 20 days | |
| 20 μg | $341 | 20 days | 20 days | |
| 50 μg | $497 | 20 days | 20 days | |
| 100 μg | $696 | 20 days | 20 days | |
| 200 μg | $1,080 | 20 days | 20 days | |
| 500 μg | $1,950 | 20 days | 20 days |
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis-SUMOstar |
| Accession Number | O43613 |
| Synonyms | Orexin/Hypocretin receptor type 1,Orexin receptor type 1 (Ox-1-R;Ox1-R;Ox1R),Hypocretin receptor type 1,HCRTR1 |
| Amino Acid | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE |
| Construction | 1-46 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 21.4 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.