Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

OR13A1 Protein, Human, Recombinant (His)

(Synonyms: OR13A1, Olfactory receptor OR10-3, Olfactory receptor 13A1) Copy Product Info

Synonyms: OR13A1, Olfactory receptor OR10-3, Olfactory receptor 13A1

Catalog No. TMPH-01808 Copy Product Info
Odorant receptor. OR13A1 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 39.3?kDa and the accession number is Q8NGR1.
OR13A1 Protein, Human, Recombinant (His)
TargetMol | Customer service
Customer service consultation
Pack SizePriceUSA StockGlobal StockQuantity
5 µg$52620 days20 days
10 µg$88620 days20 days
20 µg$1,50020 days20 days
50 µg$2,09020 days20 days
100 µg$2,75020 days20 days
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Product Introduction

Bioactivity
Bioactivity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Odorant receptor. OR13A1 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 39.3?kDa and the accession number is Q8NGR1.
Species
Human
Expression System
E. coli
TagN-10xHis
Accession NumberQ8NGR1
Amino AcidMKLWMESHLIVPETRPSPRMMSNQTLVTEFILQGFSEHPEYRVFLFSCFLFLYSGALTGN VLITLAITFNPGLHAPMYFFLLNLATMDIICTSSIMPKALASLVSEESSISYGGCMAQLY FLTWAASSELLLLTVMAYDRYAAICHPLHYSSMMSKVFCSGLATAVWLLCAVNTAIHTGL MLRLDFCGPNVIIHFFCEVPPLLLLSCSSTYVNGVMIVLADAFYGIVNFLMTIASYGFIV SSILKVKTAWGRQKAFSTCSSHLTVVCMYYTAVFYAYISPVSGYSAGKSKLAGLLYTVLS PTLNPLIYTLRNKEVKAALRKLFPFFRN
Construction1-328
Protein Purity
> 85% as determined by SDS-PAGE.
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionA Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
SynonymsOR13A1, Olfactory receptor OR10-3, Olfactory receptor 13A1
Research Background
Odorant receptor.
Chemical Properties
Molecular Weight39.3?kDa (predicted)
Storage & Solubility Information
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
StorageLyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Keywords

Related Tags: OR13A1 Protein, Human, Recombinant (His) chemical structure | OR13A1 Protein, Human, Recombinant (His) molecular weight