Lysozyme C Protein, Chicken, Recombinant(E53A)

Catalog No. TMPH-00377

Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus. Lysozyme C Protein, Chicken, Recombinant(E53A) is expressed in E. coli expression system. The predicted molecular weight is 14.4 kDa and the accession number is P00698.

Lysozyme C Protein, Chicken, Recombinant(E53A)

Catalog No. TMPH-00377

Pack Size	Price	Availability
5 μg	$185	20 days
10 μg	$297	20 days
20 μg	$515	20 days
50 μg	$713	20 days
100 μg	$916	20 days
200 μg	$1,260	20 days
500 μg	$1,930	20 days
1 mg	$2,690	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus. Lysozyme C Protein, Chicken, Recombinant(E53A) is expressed in E. coli expression system. The predicted molecular weight is 14.4 kDa and the accession number is P00698.
Species	Chicken
Expression System	E. coli
Tag	Tag Free
Accession Number	P00698
Synonyms	LYZ,Lysozyme C,Allergen Gal d IV,1,4-beta-N-acetylmuramidase C
Amino Acid	KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFASNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Construction	19-147 aa (E53A)
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	14.4 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus.