Home Tools
Log in
Cart

Lysozyme C Protein, Chicken, Recombinant(E53A)

Catalog No. TMPH-00377

Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus. Lysozyme C Protein, Chicken, Recombinant(E53A) is expressed in E. coli expression system. The predicted molecular weight is 14.4 kDa and the accession number is P00698.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Lysozyme C Protein, Chicken, Recombinant(E53A)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 515.00
100 μg 20 days $ 833.00
1 mg 20 days $ 2,450.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus. Lysozyme C Protein, Chicken, Recombinant(E53A) is expressed in E. coli expression system. The predicted molecular weight is 14.4 kDa and the accession number is P00698.
Species Chicken
Expression System E. coli
Tag Tag Free
Accession Number P00698
Amino Acid KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFASNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Construction 19-147 aa (E53A)
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 14.4 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol