Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

KDELR2 Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04268 Copy Product Info
KDELR2 Protein, Mouse, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is Q9CQM2.

KDELR2 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-04268
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

KDELR2 Protein, Mouse, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is Q9CQM2.

KDELR2 Protein, Mouse, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$51920 days20 days
10 μg$87520 days20 days
20 μg$1,48020 days20 days
50 μg$1,98020 days20 days
100 μg$2,48020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
KDELR2 Protein, Mouse, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is Q9CQM2.
Species
Mouse
Expression System
in vitro E. coli expression system
TagN-10xHis
Accession NumberQ9CQM2
Synonyms
Kdelr2,KDEL endoplasmic reticulum protein retention receptor 2 (KDEL receptor 2),ER lumen protein-retaining receptor 2
Amino Acid
MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
Construction
1-212 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight26.0 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords