Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPH-04621

Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is P20151.

Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPH-04621

Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is P20151.

Pack Size	Price	Availability
5 μg	$106	20 days
10 μg	$172	20 days
20 μg	$286	20 days
50 μg	$397	20 days
100 μg	$535	20 days
200 μg	$837	20 days
500 μg	$1,520	20 days
1 mg	$2,390	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is P20151.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P20151
Synonyms	Tissue kallikrein-2,KLK2,Kallikrein-2,Glandular kallikrein-1 (hGK-1)
Amino Acid	IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Construction	25-261 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Molecular Weight	28.2 kDa (Predicted)
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 258 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.