Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His)

TargetMol | SPR
Catalog No. TMPH-04621 Copy Product Info
Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is P20151.

Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPH-04621
Copy Product Info
TargetMol | SPR

Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is P20151.

Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10620 days20 days
10 μg$17220 days20 days
20 μg$28620 days20 days
50 μg$39720 days20 days
100 μg$53520 days20 days
200 μg$83720 days20 days
500 μg$1,52020 days20 days
1 mg$2,39020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Kallikrein 2/KLK2 Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is P20151.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP20151
Synonyms
Tissue kallikrein-2,KLK2,Kallikrein-2,Glandular kallikrein-1 (hGK-1)
Amino Acid
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Construction
25-261 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight28.2 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 258 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords