Shopping Cart
Remove All
Your shopping cart is currently empty
Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $125 | - | In Stock | |
| 10 μg | $198 | - | In Stock | |
| 20 μg | $341 | - | In Stock | |
| 50 μg | $497 | 20 days | 20 days | |
| 100 μg | $696 | 20 days | 20 days | |
| 200 μg | $1,080 | 20 days | 20 days | |
| 500 μg | $1,950 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast. |
| Species | Mouse |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis, C-Myc |
| Accession Number | P01325 |
| Synonyms | Insulin-1,Ins-1,Ins1 |
| Amino Acid | FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN |
| Construction | 25-108 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 13.0 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.