Insulin-1 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02726

Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast.

Insulin-1 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02726

Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast.

Pack Size	Price	Availability
5 μg	$125	20 days
10 μg	$198	20 days
20 μg	$341	20 days
50 μg	$497	20 days
100 μg	$696	20 days
200 μg	$1,080	20 days
500 μg	$1,950	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	N-6xHis, C-Myc
Accession Number	P01325
Synonyms	Insulin-1,Ins-1,Ins1
Amino Acid	FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Construction	25-108 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	13.0 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.