Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Insulin-1 Protein, Mouse, Recombinant (His & Myc)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02726

Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast.

Insulin-1 Protein, Mouse, Recombinant (His & Myc)

Insulin-1 Protein, Mouse, Recombinant (His & Myc)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02726
Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$125-In Stock
10 μg$198-In Stock
20 μg$341-In Stock
50 μg$49720 days20 days
100 μg$69620 days20 days
200 μg$1,08020 days20 days
500 μg$1,95020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagN-6xHis, C-Myc
Accession NumberP01325
Synonyms
Insulin-1,Ins-1,Ins1
Amino Acid
FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Construction
25-108 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Insulin-1 Protein, Mouse, Recombinant (His & Myc)
Molecular Weight13.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords