Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Insulin-1 Protein, Rat, Recombinant (hFc)

TargetMol | SPR
Catalog No. TMPH-04425 Copy Product Info
Insulin-1 Protein, Rat, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P01322.

Insulin-1 Protein, Rat, Recombinant (hFc)

Catalog No. TMPH-04425
Copy Product Info
TargetMol | SPR

Insulin-1 Protein, Rat, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P01322.

Insulin-1 Protein, Rat, Recombinant (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$4820 days20 days
10 μg$7520 days20 days
20 μg$12020 days20 days
50 μg$19620 days20 days
100 μg$29620 days20 days
200 μg$51820 days20 days
500 μg$1,08020 days20 days
1 mg$1,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Insulin-1 Protein, Rat, Recombinant (hFc) is expressed in Mammalian cell. The accession number is P01322.
Species
Rat
Expression System
HEK293 Cells
TagC-hFc1
Accession NumberP01322
Synonyms
Insulin-1,Ins-1,Ins1
Amino Acid
FVKQHLCGPHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN
Construction
25-54 aa & 90-110 aa
Protein Purity
> 95% as determined by SDS-PAGE. > 95% as determined by SEC-HPLC.
Molecular Weight37.0 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 62 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords