Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IFNAR2 Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02732 Copy Product Info
Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity. IFNAR2 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.8 kDa and the accession number is O35664.

IFNAR2 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02732
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity. IFNAR2 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.8 kDa and the accession number is O35664.

IFNAR2 Protein, Mouse, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14820 days20 days
10 μg$24720 days20 days
20 μg$41320 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity. IFNAR2 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.8 kDa and the accession number is O35664.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberO35664
Synonyms
Type I interferon receptor 2,Interferon alpha/beta receptor 2,IFN-R-2,Ifnar2,IFN-alpha/beta receptor 2
Amino Acid
SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA
Construction
22-242 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight26.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords