Shopping Cart
Remove All
Your shopping cart is currently empty
IFNAR2 Protein, Mouse, Recombinant (His)
(Synonyms: Type I interferon receptor 2, Interferon alpha/beta receptor 2, IFN-R-2, Ifnar2, IFN-alpha/beta receptor 2) Copy Product InfoSynonyms: Type I interferon receptor 2, Interferon alpha/beta receptor 2, IFN-R-2, Ifnar2, IFN-alpha/beta receptor 2
Catalog No. TMPH-02732 Copy Product Info
Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity. IFNAR2 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.8 kDa and the accession number is O35664.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $148 | 20 days | 20 days | |
| 10 μg | $247 | 20 days | 20 days | |
| 20 μg | $413 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:Greater than 90% as determined by SDS-PAGE.
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity. IFNAR2 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.8 kDa and the accession number is O35664. |
| Species | Mouse |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | O35664 |
| Amino Acid | SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA |
| Construction | 22-242 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Type I interferon receptor 2, Interferon alpha/beta receptor 2, IFN-R-2, Ifnar2, IFN-alpha/beta receptor 2 |
| Research Background |
| Molecular Weight | 26.8 kDa (predicted) |
| Storage | Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
Interferon α/β receptor 2Interferon α/beta receptor 2Interferon α/b receptor 2Interferon alpha/β receptor 2Interferon alpha/b receptor 2Interferon a/β receptor 2Interferon a/beta receptor 2Interferon a/b receptor 2IFN-α/β receptor 2IFN-α/beta receptor 2IFN-α/b receptor 2Ifnar 2IFN-alpha/β receptor 2IFN-alpha/b receptor 2IFN-a/β receptor 2IFN-a/beta receptor 2IFN-a/b receptor 2
Preview
Related Tags: IFNAR2 Protein, Mouse, Recombinant (His) chemical structure | IFNAR2 Protein, Mouse, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.