Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

HSD3B1 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-00851

HSD3B1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 33.4 kDa and the accession number is P14060.

HSD3B1 Protein, Human, Recombinant (His & Myc)

HSD3B1 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-00851
HSD3B1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 33.4 kDa and the accession number is P14060.
Pack SizePriceAvailabilityQuantity
20 μg $28420 days
100 μg $59020 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
HSD3B1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 33.4 kDa and the accession number is P14060.
Species
Human
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP14060
Synonyms
Trophoblast antigen FDO161G,Steroid Delta-isomerase,HSDB3A,HSD3B1,Dihydrotestosterone oxidoreductase,Delta-5-3-ketosteroid isomerase,3BH,3-beta-hydroxysteroid 3-dehydrogenase,3-beta-hydroxy-Delta(5)-steroid dehydrogenase,3-beta-hydroxy-5-ene steroid dehydrogenase,3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I (3-beta-HSD I),3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
Amino Acid
TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILAL
Construction
2-237 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight33.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
A bifunctional enzyme responsible for the oxidation and isomerization of 3beta-hydroxy-Delta(5)-steroid precursors to 3-oxo-Delta(4)-steroids, an essential step in steroid hormone biosynthesis. Specifically catalyzes the conversion of pregnenolone to progesterone, 17alpha-hydroxypregnenolone to 17alpha-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Additionally, catalyzes the interconversion between 3beta-hydroxy and 3-oxo-5alpha-androstane steroids controlling the bioavalability of the active forms. Specifically converts dihydrotestosterone to its inactive form 5alpha-androstanediol, that does not bind androgen receptor/AR. Also converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone. Expected to use NAD(+) as preferred electron donor for the 3beta-hydroxy-steroid dehydrogenase activity and NADPH for the 3-ketosteroid reductase activity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

δ-5-3-ketosteroid isomeraseSteroid δ-isomeraseSteroid d-isomeraseHSD3B 1d-5-3-ketosteroid isomerase3-β-hydroxy-δ(5)-steroid dehydrogenase3-β-hydroxysteroid 3-dehydrogenase3-β-hydroxy-Delta(5)-steroid dehydrogenase3-β-hydroxy-d(5)-steroid dehydrogenase3-β-hydroxy-5-ene steroid dehydrogenase3-β-HSD I3-b-hydroxy-δ(5)-steroid dehydrogenase3-b-hydroxysteroid 3-dehydrogenase3-b-hydroxy-Delta(5)-steroid dehydrogenase3-b-hydroxy-d(5)-steroid dehydrogenase3-b-hydroxy-5-ene steroid dehydrogenase3-b-HSD I3-beta-hydroxy-δ(5)-steroid dehydrogenase3-beta-hydroxy-d(5)-steroid dehydrogenase3-beta-HSD I3 β-hydroxysteroid dehydrogenase/δ 5-->4-isomerase type I (3-β-HSD I)3 β-hydroxysteroid dehydrogenase/δ 5-->4-isomerase type 13 β-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I (3-β-HSD I)3 β-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 13 β-hydroxysteroid dehydrogenase/d 5-->4-isomerase type I (3-β-HSD I)3 β-hydroxysteroid dehydrogenase/d 5-->4-isomerase type 13 β-HSDI3 b-hydroxysteroid dehydrogenase/δ 5-->4-isomerase type I (3-b-HSD I)3 b-hydroxysteroid dehydrogenase/δ 5-->4-isomerase type 13 b-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I (3-b-HSD I)3 b-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 13 b-hydroxysteroid dehydrogenase/d 5-->4-isomerase type I (3-b-HSD I)3 b-hydroxysteroid dehydrogenase/d 5-->4-isomerase type 13 b-HSDI3 beta-hydroxysteroid dehydrogenase/δ 5-->4-isomerase type I (3-beta-HSD I)3 beta-hydroxysteroid dehydrogenase/δ 5-->4-isomerase type 13 beta-hydroxysteroid dehydrogenase/d 5-->4-isomerase type I (3-beta-HSD I)3 beta-hydroxysteroid dehydrogenase/d 5-->4-isomerase type 13 beta-HSDI