GDF2 Protein, Human, Recombinant (His)

Name: GDF2 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01414
Price: 123 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Growth/differentiation factor 2, GDF-2, GDF2, Bone morphogenetic protein 9 (BMP-9), BMP9) Copy Product Info

Synonyms: Growth/differentiation factor 2, GDF-2, GDF2, Bone morphogenetic protein 9 (BMP-9), BMP9

Catalog No. TMPH-01414 Copy Product Info

Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. GDF2 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is Q9UK05.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$123	-	In Stock
10 µg	$198	-	In Stock
20 µg	$339	-	In Stock
50 µg	$497	20 days	20 days
100 µg	$696	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,890	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. GDF2 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is Q9UK05.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q9UK05
Amino Acid	HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
Construction	300-429 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Growth/differentiation factor 2, GDF-2, GDF2, Bone morphogenetic protein 9 (BMP-9), BMP9
Research Background	Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.

Chemical Properties

Molecular Weight

16.3 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.