Shopping Cart

Remove All

Your shopping cart is currently empty

Proceed to checkout Continue shopping

GDF2 Protein, Human, Recombinant (His)

Name: GDF2 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01414
Rating: 4.5 (1 reviews)

(Synonyms: Growth/differentiation factor 2, GDF-2, GDF2, Bone morphogenetic protein 9 (BMP-9), BMP9) Copy Product Info

Synonyms: Growth/differentiation factor 2, GDF-2, GDF2, Bone morphogenetic protein 9 (BMP-9), BMP9

Catalog No. TMPH-01414 Copy Product Info

Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. GDF2 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is Q9UK05.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$123	20 days	20 days
10 μg	$198	20 days	20 days
20 μg	$339	-	In Stock
50 μg	$497	20 days	20 days
100 μg	$696	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,890	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. GDF2 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.3 kDa and the accession number is Q9UK05.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q9UK05
Amino Acid	HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
Construction	300-429 aa
Protein Purity	> 90% as determined by SDS-PAGE. https://cdn.targetmol.com/group3/M00/3F/D6/CgoaEWh2NMWEPpMbAAAAABFdG0g986.jpg
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Growth/differentiation factor 2, GDF-2, GDF2, Bone morphogenetic protein 9 (BMP-9), BMP9
Research Background

Chemical Properties

Molecular Weight

16.3 kDa (predicted)

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

GDF 2BMP-9BMP 9

Related Tags: GDF2 Protein, Human, Recombinant (His) chemical structure | GDF2 Protein, Human, Recombinant (His) molecular weight