G-CSF Protein, Human, Recombinant (Isoform 2, E. coli)

Name: G-CSF Protein, Human, Recombinant (Isoform 2, E. coli)
Brand: TargetMol
SKU: TMPH-03946
Rating: 4.5 (1 reviews)

(Synonyms: Pluripoietin, Isoform Short of Granulocyte colony-stimulating factor, G-CSF, GCSF, CSF3, C17orf33) Copy Product Info

Synonyms: Pluripoietin, Isoform Short of Granulocyte colony-stimulating factor, G-CSF, GCSF, CSF3, C17orf33

Catalog No. TMPH-03946 Copy Product Info

G-CSF Protein, Human, Recombinant (Isoform 2, E. coli) is expressed in E. coli with Tag Free. The accession number is P09919-2.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$237	20 days	20 days
20 μg	$396	20 days	20 days
50 μg	$788	20 days	20 days
100 μg	$1,060	20 days	20 days
200 μg	$1,450	20 days	20 days
500 μg	$2,180	20 days	20 days
1 mg	$3,170	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	G-CSF Protein, Human, Recombinant (Isoform 2, E. coli) is expressed in E. coli with Tag Free. The accession number is P09919-2.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P09919-2
Amino Acid	TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Construction	31-204 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Pluripoietin, Isoform Short of Granulocyte colony-stimulating factor, G-CSF, GCSF, CSF3, C17orf33

Chemical Properties

Molecular Weight

18.8 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

CSF 3C17orf 33

Related Tags: G-CSF Protein, Human, Recombinant (Isoform 2, E. coli) chemical structure | G-CSF Protein, Human, Recombinant (Isoform 2, E. coli) molecular weight