Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

G-CSF Protein, Human, Recombinant (Isoform 2, E. coli)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03946 Copy Product Info
G-CSF Protein, Human, Recombinant (Isoform 2, E. coli) is expressed in E. coli with Tag Free. The accession number is P09919-2.

G-CSF Protein, Human, Recombinant (Isoform 2, E. coli)

Catalog No. TMPH-03946
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

G-CSF Protein, Human, Recombinant (Isoform 2, E. coli) is expressed in E. coli with Tag Free. The accession number is P09919-2.

G-CSF Protein, Human, Recombinant (Isoform 2, E. coli)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23720 days20 days
20 μg$39620 days20 days
50 μg$78820 days20 days
100 μg$1,06020 days20 days
200 μg$1,45020 days20 days
500 μg$2,18020 days20 days
1 mg$3,17020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
The ED50 as determined in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells is 0.03 ng/ml.
Description
G-CSF Protein, Human, Recombinant (Isoform 2, E. coli) is expressed in E. coli with Tag Free. The accession number is P09919-2.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP09919-2
Synonyms
Pluripoietin,Isoform Short of Granulocyte colony-stimulating factor,G-CSF,GCSF,CSF3,C17orf33
Amino Acid
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Construction
31-204 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight18.8 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords