Shopping Cart
Remove All
Your shopping cart is currently empty
G-CSF Protein, Human, Recombinant (Isoform 2, E. coli) is expressed in E. coli with Tag Free. The accession number is P09919-2.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $143 | 20 days | 20 days | |
| 10 μg | $237 | 20 days | 20 days | |
| 20 μg | $396 | 20 days | 20 days | |
| 50 μg | $788 | 20 days | 20 days | |
| 100 μg | $1,060 | 20 days | 20 days | |
| 200 μg | $1,450 | 20 days | 20 days | |
| 500 μg | $2,180 | 20 days | 20 days | |
| 1 mg | $3,170 | 20 days | 20 days |
| Biological Activity | The ED50 as determined in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells is 0.03 ng/ml. |
| Description | G-CSF Protein, Human, Recombinant (Isoform 2, E. coli) is expressed in E. coli with Tag Free. The accession number is P09919-2. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P09919-2 |
| Synonyms | Pluripoietin,Isoform Short of Granulocyte colony-stimulating factor,G-CSF,GCSF,CSF3,C17orf33 |
| Amino Acid | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Construction | 31-204 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 18.8 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.