Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

FGF-2 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04649 Copy Product Info
FGF-2 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P09038.

FGF-2 Protein, Human, Recombinant (His)

Catalog No. TMPH-04649
Copy Product Info
TargetMol | SPR

FGF-2 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P09038.

FGF-2 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$11620 days20 days
10 μg$189-In Stock
20 μg$317-In Stock
50 μg$45320 days20 days
100 μg$59720 days20 days
200 μg$92320 days20 days
500 μg$1,63020 days20 days
1 mg$2,56020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
FGF-2 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P09038.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP09038
Synonyms
Heparin-binding growth factor 2 (HBGF-2),Fibroblast growth factor 2,FGFB,FGF-2,FGF2,Basic fibroblast growth factor (bFGF)
Amino Acid
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Construction
143-288 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight17.9 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 286 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.