Fanconi-associated nuclease 1 Protein, Ailuropoda melanoleuca, Recombinant (His & Myc)

Name: Fanconi-associated nuclease 1 Protein, Ailuropoda melanoleuca, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-00043
Rating: 4.5 (1 reviews)

(Synonyms: Myotubularin-related protein 15, MTMR15, Fanconi-associated nuclease 1, FANCD2/FANCI-associated nuclease 1, FAN1) Copy Product Info

Synonyms: Myotubularin-related protein 15, MTMR15, Fanconi-associated nuclease 1, FANCD2/FANCI-associated nuclease 1, FAN1

Catalog No. TMPH-00043 Copy Product Info

Fanconi-associated nuclease 1 Protein, Ailuropoda melanoleuca, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 21.5 kDa and the accession number is D2HNY3.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Fanconi-associated nuclease 1 Protein, Ailuropoda melanoleuca, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 21.5 kDa and the accession number is D2HNY3.
Species	Ailuropoda melanoleuca
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	D2HNY3
Amino Acid	IHSAPAESLRAWVAAAWQAQEGRVASIVSWDRFASLQQAQDLVSCLGGPVLSGVCRRLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMLWLDELQKLGADVEVCHVVAVGAKSKSLT
Construction	898-1025 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Myotubularin-related protein 15, MTMR15, Fanconi-associated nuclease 1, FANCD2/FANCI-associated nuclease 1, FAN1
Research Background	Nuclease required for the repair of DNA interstrand cross-links (ICL) recruited at sites of DNA damage by monoubiquitinated FANCD2. Specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombination, probably in the resolution of homologous recombination intermediates. Not involved in DNA double-strand breaks resection. Acts as a 5'-3' exonuclease that anchors at a cut end of DNA and cleaves DNA successively at every third nucleotide, allowing to excise an ICL from one strand through flanking incisions. Probably keeps excising with 3'-flap annealing until it reaches and unhooks the ICL. Acts at sites that have a 5'-terminal phosphate anchor at a nick or a 1- or 2-nucleotide flap and is augmented by a 3' flap. Also has endonuclease activity toward 5'-flaps.

Chemical Properties

Molecular Weight

21.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

MTMR 15FAN 1

Related Tags: Fanconi-associated nuclease 1 Protein, Ailuropoda melanoleuca, Recombinant (His & Myc) chemical structure | Fanconi-associated nuclease 1 Protein, Ailuropoda melanoleuca, Recombinant (His & Myc) molecular weight