Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

EPOR Protein, Macaca mulatta, Recombinant (His)

Catalog No. TMPH-04523

EPOR Protein, Macaca mulatta, Recombinant (His) is expressed in Yeast. The accession number is F7GNY3.

EPOR Protein, Macaca mulatta, Recombinant (His)

EPOR Protein, Macaca mulatta, Recombinant (His)

Catalog No. TMPH-04523
EPOR Protein, Macaca mulatta, Recombinant (His) is expressed in Yeast. The accession number is F7GNY3.
Pack SizePriceAvailabilityQuantity
5 μg$11620 days
10 μg$18920 days
20 μg$31720 days
50 μg$45320 days
100 μg$59720 days
200 μg$92320 days
500 μg$1,63020 days
1 mg$2,56020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
EPOR Protein, Macaca mulatta, Recombinant (His) is expressed in Yeast. The accession number is F7GNY3.
Species
Rhesus macaque
Expression System
P. pastoris (Yeast)
TagC-10xHis
Accession NumberF7GNY3
Synonyms
Erythropoietin receptor,EPO-R,EPOR
Amino Acid
PPPNLPDPKFESKAALLVARGPEELLCFTERLEDLVCFWEEAASAGVSPDNYSFSYHLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRIIHINEVVLLDAPVGLVARLADEGGHIVLRWLPPPEAPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP
Construction
26-250 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight26.9 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 160 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.