N/A. Endoglucanase Protein, Bacillus subtilis, Recombinant (His & V5) is expressed in E. coli expression system with N-10xHis and C-V5 tag. The predicted molecular weight is 59.7 kDa and the accession number is P10475.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | N/A. Endoglucanase Protein, Bacillus subtilis, Recombinant (His & V5) is expressed in E. coli expression system with N-10xHis and C-V5 tag. The predicted molecular weight is 59.7 kDa and the accession number is P10475. |
Species | Bacillus subtilis |
Expression System | E. coli |
Tag | N-10xHis, C-V5 |
Accession Number | P10475 |
Synonyms | bglC, CMCase, gld, Cellulase, eglS, Carboxymethyl-cellulase, Endoglucanase, Endo-1,4-beta-glucanase |
Amino Acid | AGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPETPSKDKPTQENGISVQYRAGDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYKAKNKGQNFDCDYAQIGCGNVTHKFVTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKTTKKITLYDQGKLIWGTEPN |
Construction | 30-499 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 59.7 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | N/A |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
Endoglucanase Protein, Bacillus subtilis, Recombinant (His & V5) bglC CMCase gld Cellulase eglS Carboxymethyl-cellulase Endoglucanase Endo-1,4-beta-glucanase recombinant recombinant-proteins proteins protein