Shopping Cart
- Remove All
Your shopping cart is currently empty
Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates. Endoglucanase D Protein, Aspergillus kawachii, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 55.7 kDa and the accession number is Q96WQ9.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $125 | 20 days | |
| 10 μg | $198 | 20 days | |
| 20 μg | $341 | 20 days | |
| 50 μg | $497 | 20 days | |
| 100 μg | $696 | 20 days | |
| 200 μg | $1,070 | 20 days | |
| 500 μg | $1,890 | 20 days | |
| 1 mg | $2,970 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates. Endoglucanase D Protein, Aspergillus kawachii, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 55.7 kDa and the accession number is Q96WQ9. |
| Species | Aspergillus kawachii |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis-SUMOstar |
| Accession Number | Q96WQ9 |
| Synonyms | Glycosyl hydrolase 61 family protein AA9A,Endo-beta-1,4-glucanase AA9A (Endoglucanase AA9A),eglD,Cellulase AA9A,cel61A,AA9A,AA9 family lytic polysaccharide monooxygenase A |
| Amino Acid | HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ |
| Construction | 21-408 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 55.7 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.