Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Endoglucanase D Protein, Aspergillus kawachii, Recombinant (His & SUMOstar)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00123 Copy Product Info
Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates. Endoglucanase D Protein, Aspergillus kawachii, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 55.7 kDa and the accession number is Q96WQ9.

Endoglucanase D Protein, Aspergillus kawachii, Recombinant (His & SUMOstar)

Catalog No. TMPH-00123
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates. Endoglucanase D Protein, Aspergillus kawachii, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 55.7 kDa and the accession number is Q96WQ9.

Endoglucanase D Protein, Aspergillus kawachii, Recombinant (His & SUMOstar)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12520 days20 days
10 μg$19820 days20 days
20 μg$34120 days20 days
50 μg$49720 days20 days
100 μg$69620 days20 days
200 μg$1,07020 days20 days
500 μg$1,89020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates. Endoglucanase D Protein, Aspergillus kawachii, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 55.7 kDa and the accession number is Q96WQ9.
Species
Aspergillus kawachii
Expression System
P. pastoris (Yeast)
TagN-6xHis-SUMOstar
Accession NumberQ96WQ9
Synonyms
Glycosyl hydrolase 61 family protein AA9A,Endo-beta-1,4-glucanase AA9A (Endoglucanase AA9A),eglD,Cellulase AA9A,cel61A,AA9A,AA9 family lytic polysaccharide monooxygenase A
Amino Acid
HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ
Construction
21-408 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight55.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords