DUSP26 Protein, Human, Recombinant (His & SUMO)

Name: DUSP26 Protein, Human, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-01251
Rating: 4.5 (1 reviews)

(Synonyms: SKRP3, Novel amplified gene in thyroid anaplastic cancer, NATA1, MKP8, Mitogen-activated protein kinase phosphatase 8 (MAP kinase phosphatase 8;MKP-8), Low-molecular-mass dual-specificity phosphatase 4 (DSP-4;LDP-4), LDP4, DUSP26, DUSP24, Dual specificity protein phosphatase 26, Dual specificity phosphatase SKRP3) Copy Product Info

Synonyms: SKRP3, Novel amplified gene in thyroid anaplastic cancer, NATA1, MKP8, Mitogen-activated protein kinase phosphatase 8 (MAP kinase phosphatase 8;MKP-8), Low-molecular-mass dual-specificity phosphatase 4 (DSP-4;LDP-4), LDP4, DUSP26, DUSP24, Dual specificity protein phosphatase 26, Dual specificity phosphatase SKRP3

Catalog No. TMPH-01251 Copy Product Info

Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).

DUSP26 Protein, Human, Recombinant (His & SUMO)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	Q9BV47
Amino Acid	MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Construction	1-211 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	SKRP3, Novel amplified gene in thyroid anaplastic cancer, NATA1, MKP8, Mitogen-activated protein kinase phosphatase 8 (MAP kinase phosphatase 8;MKP-8), Low-molecular-mass dual-specificity phosphatase 4 (DSP-4;LDP-4), LDP4, DUSP26, DUSP24, Dual specificity protein phosphatase 26, Dual specificity phosphatase SKRP3
Research Background	Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).

Chemical Properties

Molecular Weight

39.9 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.