DHODH Protein, Human, Recombinant (His)

Name: DHODH Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01225
Price: 75 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: mitochondrial, Dihydroorotate oxidase, Dihydroorotate dehydrogenase (quinone), mitochondrial, DHODH, DHOdehase) Copy Product Info

Synonyms: mitochondrial, Dihydroorotate oxidase, Dihydroorotate dehydrogenase (quinone), mitochondrial, DHODH, DHOdehase

Catalog No. TMPH-01225 Copy Product Info

Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	-	In Stock
10 µg	$119	-	In Stock
20 µg	$198	In Stock	In Stock
50 µg	$297	20 days	20 days
100 µg	$427	-	In Stock
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:85%

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
Species	Human
Expression System	E. coli
Tag	N-10xHis
Accession Number	Q02127
Amino Acid	TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Construction	31-395 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Synonyms	mitochondrial, Dihydroorotate oxidase, Dihydroorotate dehydrogenase (quinone), mitochondrial, DHODH, DHOdehase
Research Background	Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Chemical Properties

Molecular Weight

45.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.