Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

DHODH Protein, Human, Recombinant (His)

Catalog No. TMPH-01225

Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

DHODH Protein, Human, Recombinant (His)

DHODH Protein, Human, Recombinant (His)

Catalog No. TMPH-01225
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
Pack SizePriceAvailabilityQuantity
20 μg$198In Stock
100 μg$427In Stock
1 mg$1,83020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
Species
Human
Expression System
E. coli
TagN-10xHis
Accession NumberQ02127
Synonyms
mitochondrial,Dihydroorotate oxidase,Dihydroorotate dehydrogenase (quinone), mitochondrial,DHODH,DHOdehase
Amino Acid
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Construction
31-395 aa
Protein Purity
> 85% as determined by SDS-PAGE.
DHODH Protein, Human, Recombinant (His)
Molecular Weight45.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.