Shopping Cart
- Remove All
- Your shopping cart is currently empty
CPN1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P15169.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $143 | 20 days | |
10 μg | $236 | 20 days | |
20 μg | $395 | 20 days | |
50 μg | $498 | 20 days | |
100 μg | $593 | 20 days | |
200 μg | $849 | 20 days | |
500 μg | $1,370 | 20 days | |
1 mg | $1,980 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | CPN1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P15169. |
Species | Human |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | P15169 |
Synonyms | Serum carboxypeptidase N (SCPN),Plasma carboxypeptidase B,Lysine carboxypeptidase,Kininase-1,CPN1,CPN,Carboxypeptidase N small subunit,Carboxypeptidase N polypeptide 1,Carboxypeptidase N catalytic chain,Arginine carboxypeptidase,Anaphylatoxin inactivator,ACBP |
Amino Acid | VTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA |
Construction | 21-458 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 50.2 kDa (Predicted) |
Endotoxin | Not tested. |
Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 328 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.