Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CPN1 Protein, Human, Recombinant

TargetMol | SPR
Catalog No. TMPH-04691 Copy Product Info
CPN1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P15169.

CPN1 Protein, Human, Recombinant

Catalog No. TMPH-04691
Copy Product Info
TargetMol | SPR

CPN1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P15169.

CPN1 Protein, Human, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$143-In Stock
10 μg$236-In Stock
20 μg$395-In Stock
50 μg$49820 days20 days
100 μg$59320 days20 days
200 μg$84920 days20 days
500 μg$1,37020 days20 days
1 mg$1,98020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CPN1 Protein, Human, Recombinant is expressed in E. coli. The accession number is P15169.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP15169
Synonyms
Serum carboxypeptidase N (SCPN),Plasma carboxypeptidase B,Lysine carboxypeptidase,Kininase-1,CPN1,CPN,Carboxypeptidase N small subunit,Carboxypeptidase N polypeptide 1,Carboxypeptidase N catalytic chain,Arginine carboxypeptidase,Anaphylatoxin inactivator,ACBP
Amino Acid
VTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
Construction
21-458 aa
Protein Purity
> 85% as determined by SDS-PAGE.
CPN1 Protein, Human, Recombinant
Molecular Weight50.2 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 328 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords