Home Tools
Log in
Cart

Corticoliberin Protein, Mouse, Recombinant (His & KSI)

Catalog No. TMPH-02608
Synonyms: Crh, CRF, Corticotropin-releasing hormone, Gm1347, Corticoliberin, Corticotropin-releasing factor

Hormone regulating the release of corticotropin from pituitary gland. Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Corticoliberin Protein, Mouse, Recombinant (His & KSI)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 284.00
100 μg 20 days $ 537.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Hormone regulating the release of corticotropin from pituitary gland. Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile.
Species Mouse
Expression System E. coli
Tag N-terminal 6xHis-KSI-tagged
Accession Number Q8CIT0
Synonyms Crh, CRF, Corticotropin-releasing hormone, Gm1347, Corticoliberin, Corticotropin-releasing factor
Amino Acid SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 145-185 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 20.1 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Hormone regulating the release of corticotropin from pituitary gland. Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Corticoliberin Protein, Mouse, Recombinant (His & KSI) Crh CRF Corticotropin-releasing hormone Gm1347 Corticoliberin Corticotropin-releasing factor recombinant recombinant-proteins proteins protein

 

TargetMol