Home Tools
Log in
Cart

Chymase Protein, Canine, Recombinant (His & SUMO)

Catalog No. TMPH-00486
Synonyms: Chymase, Alpha-chymase, CMA1, Mast cell protease I

Chymase Protein, Canine, Recombinant (His & SUMO) is expressed in E. coli.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Chymase Protein, Canine, Recombinant (His & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Chymase Protein, Canine, Recombinant (His & SUMO) is expressed in E. coli.
Species Canine
Expression System E. coli
Tag N-6xHis-SUMO
Accession Number P21842
Synonyms Chymase, Alpha-chymase, CMA1, Mast cell protease I
Amino Acid IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
Construction 22-249 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 41.5 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Chymase Protein, Canine, Recombinant (His & SUMO) Chymase Alpha-chymase CMA1 Mast cell protease I recombinant recombinant-proteins proteins protein

 

TargetMol