CBR1 Protein, Human, Recombinant (His)

Name: CBR1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01040
Rating: 4.5 (1 reviews)

(Synonyms: Short chain dehydrogenase/reductase family 21C member 1, SDR21C1, Prostaglandin-E(2) 9-reductase, Prostaglandin 9-ketoreductase (PG-9-KR), NADPH-dependent carbonyl reductase 1, CRN, CBR1, CBR, Carbonyl reductase [NADPH] 1, Alcohol dehydrogenase [NAD(P)+] CBR1, 20-beta-hydroxysteroid dehydrogenase, 15-hydroxyprostaglandin dehydrogenase [NADP(+)]) Copy Product Info

Synonyms: Short chain dehydrogenase/reductase family 21C member 1, SDR21C1, Prostaglandin-E(2) 9-reductase, Prostaglandin 9-ketoreductase (PG-9-KR), NADPH-dependent carbonyl reductase 1, CRN, CBR1, CBR, Carbonyl reductase [NADPH] 1, Alcohol dehydrogenase [NAD(P)+] CBR1, 20-beta-hydroxysteroid dehydrogenase, 15-hydroxyprostaglandin dehydrogenase [NADP(+)]

Catalog No. TMPH-01040 Copy Product Info

CBR1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 32.2 kDa and the accession number is P16152.

Pack Size	Price	USA Stock	Global Stock
5 µg	$86	20 days	20 days
10 µg	$138	20 days	20 days
20 µg	$231	20 days	20 days
50 µg	$348	20 days	20 days
100 µg	$480	20 days	20 days
200 µg	$743	20 days	20 days
500 µg	$1,330	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	CBR1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 32.2 kDa and the accession number is P16152.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P16152
Amino Acid	SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Construction	2-277 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Short chain dehydrogenase/reductase family 21C member 1, SDR21C1, Prostaglandin-E(2) 9-reductase, Prostaglandin 9-ketoreductase (PG-9-KR), NADPH-dependent carbonyl reductase 1, CRN, CBR1, CBR, Carbonyl reductase [NADPH] 1, Alcohol dehydrogenase [NAD(P)+] CBR1, 20-beta-hydroxysteroid dehydrogenase, 15-hydroxyprostaglandin dehydrogenase [NADP(+)]
Research Background	NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.

Chemical Properties

Molecular Weight

32.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.