Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: CTSO1, CTSO, Cathepsin O

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $219 | - | In Stock | |
| 10 μg | $365 | 20 days | 20 days | |
| 20 μg | $613 | - | In Stock | |
| 50 μg | $1,160 | 20 days | 20 days | |
| 100 μg | $1,890 | 20 days | 20 days |
| Description | Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Cathepsin O Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P43234. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | N-10xHis, C-Myc |
| Accession Number | P43234 |
| Amino Acid | LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV |
| Construction | 108-321 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. https://cdn.targetmol.com/group3/M00/A2/F0/CgoaEWoNJOCERdjCAAAAAIZAUz0053.png |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | CTSO1, CTSO, Cathepsin O |
| Research Background |
| Molecular Weight | 28.5 kDa (predicted) |
| Storage | Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.