Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Cathepsin O Protein, Human, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01063 Copy Product Info
Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Cathepsin O Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P43234.

Cathepsin O Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01063
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Cathepsin O Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P43234.

Cathepsin O Protein, Human, Recombinant (His & Myc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$219-In Stock
10 μg$36520 days20 days
20 μg$613-In Stock
50 μg$1,16020 days20 days
100 μg$1,89020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Cathepsin O Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P43234.
Species
Human
Expression System
HEK293 Cells
TagN-10xHis, C-Myc
Accession NumberP43234
Synonyms
CTSO1,CTSO,Cathepsin O
Amino Acid
LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV
Construction
108-321 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight28.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords