Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Cathepsin O Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01063

Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Cathepsin O Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P43234.

Cathepsin O Protein, Human, Recombinant (His & Myc)

Cathepsin O Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01063
Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Cathepsin O Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P43234.
Pack SizePriceAvailabilityQuantity
20 μg $61420 days
100 μg $1,89020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Cathepsin O Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 28.5 kDa and the accession number is P43234.
Species
Human
Expression System
HEK293 Cells
TagN-10xHis, C-Myc
Accession NumberP43234
Synonyms
CTSO1,CTSO,Cathepsin O
Amino Acid
LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV
Construction
108-321 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight28.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords