Home Tools
Log in
Cart

Cathepsin C Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02628
Synonyms: Dipeptidyl transferase, Dipeptidyl peptidase I, Cathepsin J, DPPI, Ctsc, DPP-I, Cathepsin C, Dipeptidyl peptidase 1

Thiol protease. Has dipeptidylpeptidase activity. Can act as both an exopeptidase and endopeptidase. Can degrade glucagon. Plays a role in the generation of cytotoxic lymphocyte effector function.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Cathepsin C Protein, Mouse, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 284.00
100 μg 20 days $ 537.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Thiol protease. Has dipeptidylpeptidase activity. Can act as both an exopeptidase and endopeptidase. Can degrade glucagon. Plays a role in the generation of cytotoxic lymphocyte effector function.
Species Mouse
Expression System E. coli
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number P97821
Synonyms Dipeptidyl transferase, Dipeptidyl peptidase I, Cathepsin J, DPPI, Ctsc, DPP-I, Cathepsin C, Dipeptidyl peptidase 1
Amino Acid DTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNW Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 25-134 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 20.1 kDa as predicted
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Thiol protease. Has dipeptidylpeptidase activity. Can act as both an exopeptidase and endopeptidase. Can degrade glucagon. Plays a role in the generation of cytotoxic lymphocyte effector function.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Cathepsin C Protein, Mouse, Recombinant (His & Myc) Dipeptidyl transferase Dipeptidyl peptidase I Cathepsin J DPPI Ctsc DPP-I Cathepsin C Dipeptidyl peptidase 1 recombinant recombinant-proteins proteins protein

 

TargetMol