Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Cathepsin K Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPH-04684

Cathepsin K Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is P43235.

Cathepsin K Protein, Human, Recombinant (Yeast, His)

Cathepsin K Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPH-04684
Cathepsin K Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is P43235.
Pack SizePriceAvailabilityQuantity
20 μg$25920 days
100 μg$48720 days
1 mg$1,98020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Cathepsin K Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is P43235.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP43235
Synonyms
CTSO2,CTSO,CTSK,Cathepsin X,Cathepsin O2,Cathepsin O,Cathepsin K
Amino Acid
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Construction
115-329 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight25.5 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 321 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords