Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03829

Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915.

Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His)

Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03829
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915.
Pack SizePriceAvailabilityQuantity
5 μg$6420 days
10 μg$9820 days
20 μg$16520 days
50 μg$32320 days
100 μg$61320 days
200 μg$1,17020 days
500 μg$2,77020 days
1 mg$3,96020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
The esterase activity is determined to be greater than 500 pmol/min/ug
Description
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberP00915
Synonyms
Cyanamide hydratase CA1,Carbonic anhydrase I (CA-I),Carbonic anhydrase B (CAB),Carbonic anhydrase 1,Carbonate dehydratase I,CA1
Amino Acid
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Construction
2-261 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight29.93 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords