Shopping Cart
Remove All
Your shopping cart is currently empty
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His)
Catalog No. TMPH-03829
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915.
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His)
Catalog No. TMPH-03829
Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $64 | 20 days | 20 days | |
| 10 μg | $98 | 20 days | 20 days | |
| 20 μg | $165 | 20 days | 20 days | |
| 50 μg | $323 | 20 days | 20 days | |
| 100 μg | $613 | 20 days | 20 days | |
| 200 μg | $1,170 | 20 days | 20 days | |
| 500 μg | $2,770 | 20 days | 20 days | |
| 1 mg | $3,960 | 20 days | 20 days |
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Information
| Biological Activity | The esterase activity is determined to be greater than 500 pmol/min/ug |
| Description | Carbonic Anhydrase 1 Protein, Human, Recombinant (Active, His) is expressed in E. coli with C-6xHis. The accession number is P00915. |
| Species | Human |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | P00915 |
| Synonyms | Cyanamide hydratase CA1,Carbonic anhydrase I (CA-I),Carbonic anhydrase B (CAB),Carbonic anhydrase 1,Carbonate dehydratase I,CA1 |
| Amino Acid | ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
| Construction | 2-261 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 29.93 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0 |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | Shipping with blue ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.