CA5A Protein, Human, Recombinant

Catalog No. TMPH-01038 Copy Product Info

Reversible hydration of carbon dioxide. Low activity. CA5A Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 30.6 kDa and the accession number is P35218.

CA5A Protein, Human, Recombinant

Catalog No. TMPH-01038

Copy Product Info

Pack Size	Price	USA Stock	Global Stock
5 μg	$142	20 days	20 days
10 μg	$235	20 days	20 days
20 μg	$392	20 days	20 days
50 μg	$512	20 days	20 days
100 μg	$627	20 days	20 days
200 μg	$1,130	20 days	20 days
500 μg	$2,490	20 days	20 days
1 mg	$4,600	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Reversible hydration of carbon dioxide. Low activity. CA5A Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 30.6 kDa and the accession number is P35218.
Species	Human
Expression System	HEK293 Cells
Tag	Tag Free
Accession Number	P35218
Synonyms	mitochondrial,Carbonic anhydrase VA (CA-VA),Carbonic anhydrase 5A, mitochondrial,Carbonate dehydratase VA,CA5A,CA5
Amino Acid	CAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
Construction	39-305 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	30.6 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Reversible hydration of carbon dioxide. Low activity.