C5AR1 Protein, Mouse, Recombinant (His & KSI)

Name: C5AR1 Protein, Mouse, Recombinant (His & KSI)
Brand: TargetMol
SKU: TMPH-04212
Rating: 4.5 (1 reviews)

(Synonyms: CD88, C5r1, C5ar1, C5ar, C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin chemotactic receptor (C5a-R;C5aR)) Copy Product Info

Synonyms: CD88, C5r1, C5ar1, C5ar, C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin chemotactic receptor (C5a-R;C5aR)

Catalog No. TMPH-04212 Copy Product Info

C5AR1 Protein, Mouse, Recombinant (His & KSI) is expressed in E. coli with N-6xHis-KSI. The accession number is P30993.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$89	20 days	20 days
10 µg	$143	20 days	20 days
20 µg	$237	20 days	20 days
50 µg	$339	20 days	20 days
100 µg	$446	20 days	20 days
200 µg	$688	20 days	20 days
500 µg	$1,230	20 days	20 days
1 mg	$1,920	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	C5AR1 Protein, Mouse, Recombinant (His & KSI) is expressed in E. coli with N-6xHis-KSI. The accession number is P30993.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis-KSI
Accession Number	P30993
Amino Acid	QGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTTDTSTRKSQAV
Construction	306-351 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	CD88, C5r1, C5ar1, C5ar, C5a anaphylatoxin chemotactic receptor 1, C5a anaphylatoxin chemotactic receptor (C5a-R;C5aR)

Chemical Properties

Molecular Weight

20.4 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.