BRCC3 Protein, Mouse, Recombinant (His)

Name: BRCC3 Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04294
Rating: 4.5 (1 reviews)

(Synonyms: Lys-63-specific deubiquitinase BRCC36, C6.1a, BRISC complex subunit BRCC36, Brcc36, Brcc3, BRCA1-A complex subunit BRCC36, BRCA1/BRCA2-containing complex subunit 36, BRCA1/BRCA2-containing complex subunit 3) Copy Product Info

Synonyms: Lys-63-specific deubiquitinase BRCC36, C6.1a, BRISC complex subunit BRCC36, Brcc36, Brcc3, BRCA1-A complex subunit BRCC36, BRCA1/BRCA2-containing complex subunit 36, BRCA1/BRCA2-containing complex subunit 3

Catalog No. TMPH-04294 Copy Product Info

Purity: 96%

BRCC3 Protein, Mouse, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is P46737.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$98	20 days	20 days
10 µg	$169	-	In Stock
20 µg	$283	-	In Stock
50 µg	$397	20 days	20 days
100 µg	$537	20 days	20 days
200 µg	$828	20 days	20 days
500 µg	$1,480	20 days	20 days
1 mg	$2,300	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:96%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	BRCC3 Protein, Mouse, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is P46737.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis
Accession Number	P46737
Amino Acid	AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHITIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMEELSSLE
Construction	2-291 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Lys-63-specific deubiquitinase BRCC36, C6.1a, BRISC complex subunit BRCC36, Brcc36, Brcc3, BRCA1-A complex subunit BRCC36, BRCA1/BRCA2-containing complex subunit 36, BRCA1/BRCA2-containing complex subunit 3

Chemical Properties

Molecular Weight

36.8 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.