Shopping Cart
Remove All
Your shopping cart is currently empty
Bovine coronavirus (strain 98TXSF-110-LUN) Protein I (His)
(Synonyms: Protein in nucleocapsid ORF, Protein I, N internal ORF protein (IORF), Accessory protein N2) Copy Product InfoSynonyms: Protein in nucleocapsid ORF, Protein I, N internal ORF protein (IORF), Accessory protein N2
Catalog No. TMPH-00253 Copy Product Info
Structural protein that is not essential for the viral replication either in tissue culture or in its natural host. Bovine coronavirus (strain 98TXSF-110-LUN) Protein I (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 24.4 kDa and the accession number is Q8V431.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $75 | 20 days | 20 days | |
| 10 µg | $119 | 20 days | 20 days | |
| 20 µg | $198 | 20 days | 20 days | |
| 50 µg | $297 | 20 days | 20 days | |
| 100 µg | $427 | 20 days | 20 days | |
| 200 µg | $658 | 20 days | 20 days | |
| 500 µg | $1,170 | 20 days | 20 days | |
| 1 mg | $1,830 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Structural protein that is not essential for the viral replication either in tissue culture or in its natural host. Bovine coronavirus (strain 98TXSF-110-LUN) Protein I (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 24.4 kDa and the accession number is Q8V431. |
| Species | BCoV |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | Q8V431 |
| Amino Acid | MASLSGPISPINLEMFKPGVEELNPSKLLLLSNHQEGMLYPTILGSLELLSFKRERSLNLQRDKVCLLHQESQLLKLRGTGTDTTDVPLKQPMATSVNCCHDGIFTILEQDRMPKTSMAPTLTESTGSLVTRLMSIPRLTFSIGTQVAMRLFRLGFRLARYSLRVTILKAQEGLLLIPDLLHAHPVEPLVQDRAVEPILAIEPLPLV |
| Construction | 1-207 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Protein in nucleocapsid ORF, Protein I, N internal ORF protein (IORF), Accessory protein N2 |
| Research Background | Structural protein that is not essential for the viral replication either in tissue culture or in its natural host. |
| Molecular Weight | 24.4 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Preview
Related Tags: Bovine coronavirus (strain 98TXSF-110-LUN) Protein I (His) chemical structure | Bovine coronavirus (strain 98TXSF-110-LUN) Protein I (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.