BoNT/D Protein, Clostridium botulinum, Recombinant (B2M & His)

BoNT/D Protein, Clostridium botulinum, Recombinant (B2M & His) is expressed in E. coli.

Pack Size	Availability	Price/USD
20 μg	20 days	$ 360.00
100 μg	20 days	$ 678.00
1 mg	20 days	$ 2,300.00

Description

BoNT/D Protein, Clostridium botulinum, Recombinant (B2M & His) is expressed in E. coli.

Species	Clostridium botulinum
Expression System	E. coli
Tag	N-terminal 6xHis-B2M-tagged
Accession Number	P19321
Synonyms	Bontoxilysin-D, Botulinum neurotoxin type D, BoNT/D, botD
Amino Acid	MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASLTLQGQQSNPSFEGFGTLSILKVAPEFLLTFSDVTSNQSSAVLGKSIFCMDPVIALMHELTHSLHQLYGINIPSDKRIRPQVSEGFFSQDGPNVQFEELYTFGGLDVEIIPQIERSQLREKALGHYKDIAKRLNNINKTIPSSWISNIDKYKKIFSEKYNFDKDNTGNFVVNIDKFNSLYSDLTNVMSEVVYSSQYNVKNRTHYFSRHYLPVFANILDDNIYTIRDGFNLTNKGFNIENSGQNIERNPALQKLSSESVVDLFTKVCLRLTK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction	1-442 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	64.5 kDa as predicted

Formulation	Tris-based buffer,50% glycerol
Reconstitution	A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage	Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shipping	In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Research Background	Botulinum toxin causes flaccid paralysis by inhibiting neurotransmitter (acetylcholine) release from the presynaptic membranes of nerve terminals of the eukaryotic host skeletal and autonomic nervous system, with frequent heart or respiratory failure. Precursor of botulinum neurotoxin D for which a proteinaceous coreceptor is controversial. In double SV2A/SV2B knockout mice this toxin does not degrade its synaptobrevin target; introducing SV2A, SV2B or SV2C restores target cleavage. Recognition of SV2 by this toxin does not occur via SV2 glycosylation or its large extracellular loop 4. Another group does not find a convincing interaction with SV2. Thus a protein receptor for this BoNT serotype has yet to be definitively proven. Recognizes at least 1 complex polysialylated ganglioside found on neural tissue. Electrical stimulation increases uptake of toxin in an ex vivo assay, presumably by transiently exposing a receptor usually found in eukaryotic target synaptic vesicles. Upon synaptic vesicle recycling the toxin is taken up via the endocytic pathway; when the pH of the toxin-containing endosome drops a structural rearrangement occurs so that the N-terminus of the heavy chain (HC) forms pores that allows the light chain (LC) to translocate into the cytosol. Once in the cytosol the disulfide bond linking the 2 subunits is reduced and LC cleaves its target protein on synaptic vesicles, preventing their fusion with the cytoplasmic membrane and thus neurotransmitter release. Requires complex eukaryotic host polysialogangliosides for full neurotoxicity and for binding to neurons.; Has proteolytic activity. After translocation into the eukaryotic host cytosol, inhibits neurotransmitter release by acting as a zinc endopeptidase that cleaves the '61-Lys-\|-Leu-62' bond of synaptobrevin-1 (VAMP1), and the equivalent 'Lys-\|-Leu' sites in VAMP2 and VAMP3. Cleaves the '49-Lys-\|-Ile-50' bond of A.californica synaptobrevin (AC P35589). This chain probably has to be partially unfolded to translocate into the eukaryotic host cell cytosol.; Responsible for host epithelial cell transcytosis, host nerve cell targeting and translocation of light chain (LC) into eukaryotic host cell cytosol. Composed of 3 subdomains; the translocation domain (TD), and N-terminus and C-terminus of the receptor-binding domain (RBD). The RBD is responsible for the adherence of the toxin to the eukaryotic target cell surface. The N-terminus of the TD wraps an extended belt around the perimeter of the LC, protecting Zn(2+) in the active site; it may also prevent premature LC dissociation from the translocation channel and protect toxin prior to translocation. The TD inserts into synaptic vesicle membrane to allow translocation into the host cytosol. The RBD binds eukaryotic host phosphatidylethanolamine, which may serve as toxin receptor. Treatment of synaptosomes with proteinase K does not reduce HC binding, suggesting there is no protein receptor or it is protected from extracellular proteases. HC significantly decreases uptake and toxicity of whole BoNT/D. HC also interferes with uptake of tetanus toxin. Has 2 closely located carbohydrate-binding receptor sites and binds at least 1 GT1b ganglioside. Bind gangliosides in the order GD2 > GT1b > GD1b. Interacts with eukaryotic target protein SV2B (synaptic vesicle glycoprotein 2B). Expression of SV2A, SV2B or SV2C in mice knocked-out for the SV2 proteins restores entry of BoNT/D and cleavage of VAMP2, suggesting SV2 acts as its receptor. Unlike BoNT/A and BoNT/E, toxin uptake is not mediated by large extracellular loop 4 of SV2. Another group finds very poor interaction with SV2 proteins, suggesting the possible protein receptor may not have been identified.

Calculator

Reconstitution Calculator

Recombinant Proteins Dilute Calculator

Specific Activity Calculator

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

bottom

BoNT/D Protein, Clostridium botulinum, Recombinant (B2M & His)

Calculator

Tech Support

Keywords