asFP595 Protein, Anemonia sulcata, Recombinant (hFc)

Name: asFP595 Protein, Anemonia sulcata, Recombinant (hFc)
Brand: TargetMol
SKU: TMPH-00058
Rating: 4.5 (1 reviews)

(Synonyms: GFP-like non-fluorescent chromoprotein FP595, asFP595) Copy Product Info

Synonyms: GFP-like non-fluorescent chromoprotein FP595, asFP595

Catalog No. TMPH-00058 Copy Product Info

Pigment protein that is intensely purple in color.

asFP595 Protein, Anemonia sulcata, Recombinant (hFc)

Pack Size	Price	USA Stock	Global Stock
5 µg	$219	20 days	20 days
10 µg	$365	20 days	20 days
20 µg	$613	20 days	20 days
50 µg	$1,160	20 days	20 days
100 µg	$1,890	20 days	20 days
200 µg	$2,890	20 days	20 days
500 µg	$5,160	20 days	20 days
1 mg	$7,960	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Pigment protein that is intensely purple in color.
Species	Anemonia sulcata
Expression System	HEK293 Cells
Tag	C-hFC
Accession Number	Q9GZ28
Amino Acid	MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Construction	1-62 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	GFP-like non-fluorescent chromoprotein FP595, asFP595
Research Background	Pigment protein that is intensely purple in color.

Chemical Properties

Molecular Weight

35.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

asFP-595

Related Tags: asFP595 Protein, Anemonia sulcata, Recombinant (hFc) chemical structure | asFP595 Protein, Anemonia sulcata, Recombinant (hFc) molecular weight