APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.5 kDa and the accession number is Q1PER6.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 360.00 | |
100 μg | 20 days | $ 678.00 | |
1 mg | 20 days | $ 2,300.00 |
Description | APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.5 kDa and the accession number is Q1PER6. |
Species | Arabidopsis thaliana |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | Q1PER6 |
Synonyms | APX1b, APX2, L-ascorbate peroxidase 2, cytosolic, L-ascorbate peroxidase 1b, APX1B, AtAPx02 |
Amino Acid | KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK |
Construction | 4-250 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 31.5 kDa (predicted) |
Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) APX1b APX2 L-ascorbate peroxidase 2, cytosolic L-ascorbate peroxidase 1b APX1B AtAPx02 recombinant recombinant-proteins proteins protein