Home Tools
Log in
Cart

APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His)

Catalog No. TMPH-00096
Synonyms: APX1b, APX2, L-ascorbate peroxidase 2, cytosolic, L-ascorbate peroxidase 1b, APX1B, AtAPx02

APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.5 kDa and the accession number is Q1PER6.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.5 kDa and the accession number is Q1PER6.
Species Arabidopsis thaliana
Expression System E. coli
Tag N-6xHis
Accession Number Q1PER6
Synonyms APX1b, APX2, L-ascorbate peroxidase 2, cytosolic, L-ascorbate peroxidase 1b, APX1B, AtAPx02
Amino Acid KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK
Construction 4-250 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 31.5 kDa (predicted)
Formulation Lyophilized from a solution filtered through a 0.22 μm filter, containing 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

APX2, cytosolic Protein, Arabidopsis thaliana, Recombinant (His) APX1b APX2 L-ascorbate peroxidase 2, cytosolic L-ascorbate peroxidase 1b APX1B AtAPx02 recombinant recombinant-proteins proteins protein

 

TargetMol