Shopping Cart
Remove All
Your shopping cart is currently empty
Apolipoprotein E/APOE Protein, Human, Recombinant (R163C, His & Myc)
Copy Product InfoSynonyms:
Catalog No. TMPH-04827 Copy Product Info
Apolipoprotein E/APOE Protein, Human, Recombinant (R163C, His & Myc) is expressed in HEK293 Cells. The accession number is P02649.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 50 µg | Inquiry | - | In Stock |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Select Batch
Purity:85%（SDS-PAGE）
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | Apolipoprotein E/APOE Protein, Human, Recombinant (R163C, His & Myc) is expressed in HEK293 Cells. The accession number is P02649. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | N-10xHis, C-Myc |
| Accession Number | P02649 |
| Amino Acid | KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLCKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH |
| Construction | 19-317 aa |
| Protein Purity | ≥85% as determined by SDS-PAGE.  |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Molecular Weight | 39.2 kDa (Predicted); 44 kDa (Reducing condition due to glycosylation) |
| Relative Density. | no data available |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Preview
Related Tags: Apolipoprotein E/APOE Protein, Human, Recombinant (R163C, His & Myc) chemical structure | Apolipoprotein E/APOE Protein, Human, Recombinant (R163C, His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.