APOC3 Protein, Cynomolgus, Recombinant (His)

Name: APOC3 Protein, Cynomolgus, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04825
Rating: 4.5 (1 reviews)

Copy Product Info

Synonyms:

Catalog No. TMPH-04825 Copy Product Info

APOC3 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 Cells. The accession number is P18659.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$102	35 days	35 days
10 µg	$163	35 days	35 days
20 µg	$261	7-10 days	7-10 days
50 µg	$353	35 days	35 days
100 µg	$459	35 days	35 days
500 µg	$1,840	35 days	35 days
1 mg	$3,250	35 days	35 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	APOC3 Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 Cells. The accession number is P18659.
Species	Cynomolgus monkey
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	P18659
Amino Acid	SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA
Construction	21-99 aa
Protein Purity	> 95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Research Background	Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

Chemical Properties

Molecular Weight	10.4 kDa (predicted)
Relative Density.	no data available

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.