ALDH1A1 Protein, Mouse, Recombinant (His)

Name: ALDH1A1 Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04201
Rating: 4.5 (1 reviews)

(Synonyms: Retinal dehydrogenase 1 (RALDH 1;RalDH1), ALHDII, ALDH-E1, Aldh1a1, Aldh1, Aldehyde dehydrogenase, cytosolic, Aldehyde dehydrogenase family 1 member A1, Aldehyde dehydrogenase 1A1, Ahd-2, Ahd2, 3-deoxyglucosone dehydrogenase) Copy Product Info

Synonyms: Retinal dehydrogenase 1 (RALDH 1;RalDH1), ALHDII, ALDH-E1, Aldh1a1, Aldh1, Aldehyde dehydrogenase, cytosolic, Aldehyde dehydrogenase family 1 member A1, Aldehyde dehydrogenase 1A1, Ahd-2, Ahd2, 3-deoxyglucosone dehydrogenase

Catalog No. TMPH-04201 Copy Product Info

ALDH1A1 Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is P24549.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$123	20 days	20 days
10 μg	$198	20 days	20 days
20 μg	$338	20 days	20 days
50 μg	$488	20 days	20 days
100 μg	$646	20 days	20 days
200 μg	$998	20 days	20 days
500 μg	$1,780	20 days	20 days
1 mg	$2,760	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	ALDH1A1 Protein, Mouse, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is P24549.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P24549
Amino Acid	SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS
Construction	2-501 aa
Protein Purity	>90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Retinal dehydrogenase 1 (RALDH 1;RalDH1), ALHDII, ALDH-E1, Aldh1a1, Aldh1, Aldehyde dehydrogenase, cytosolic, Aldehyde dehydrogenase family 1 member A1, Aldehyde dehydrogenase 1A1, Ahd-2, Ahd2, 3-deoxyglucosone dehydrogenase

Chemical Properties

Molecular Weight

56.3 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

RALDH1RALDH 1ALHD IIAldh1a 1ALDH E-1Aldh 1Ahd 2

Related Tags: ALDH1A1 Protein, Mouse, Recombinant (His) chemical structure | ALDH1A1 Protein, Mouse, Recombinant (His) molecular weight