Shopping Cart
Remove All
Your shopping cart is currently empty
ADIPOR1 Protein, Human, Recombinant (His & Myc & SUMO)
(Synonyms: TESBP1A, Progestin and adipoQ receptor family member I, Progestin and adipoQ receptor family member 1, PAQR1, ADIPOR1, Adiponectin receptor protein 1) Copy Product InfoSynonyms: TESBP1A, Progestin and adipoQ receptor family member I, Progestin and adipoQ receptor family member 1, PAQR1, ADIPOR1, Adiponectin receptor protein 1
Catalog No. TMPH-00905 Copy Product Info
ADIPOR1 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in in vitro E. coli expression system.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $526 | 20 days | 20 days | |
| 10 µg | $886 | 20 days | 20 days | |
| 20 µg | $1,500 | 20 days | 20 days | |
| 50 µg | $2,090 | 20 days | 20 days | |
| 100 µg | $2,750 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | ADIPOR1 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in in vitro E. coli expression system. |
| Species | Human |
| Expression System | in vitro E. coli |
| Tag | N-10xHis-SUMO, C-Myc |
| Accession Number | Q96A54 |
| Amino Acid | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL |
| Construction | 1-375 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | TESBP1A, Progestin and adipoQ receptor family member I, Progestin and adipoQ receptor family member 1, PAQR1, ADIPOR1, Adiponectin receptor protein 1 |
| Research Background | Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin. |
| Molecular Weight | 62.6 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Preview
Related Tags: ADIPOR1 Protein, Human, Recombinant (His & Myc & SUMO) chemical structure | ADIPOR1 Protein, Human, Recombinant (His & Myc & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.