Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Abrin-a Protein, Abrus precatorius, Recombinant

TargetMol | SPR
Catalog No. TMPH-04797 Copy Product Info
Abrin-a Protein, Abrus precatorius, Recombinant is expressed in E. coli. The accession number is P11140.

Abrin-a Protein, Abrus precatorius, Recombinant

Catalog No. TMPH-04797
Copy Product Info
TargetMol | SPR

Abrin-a Protein, Abrus precatorius, Recombinant is expressed in E. coli. The accession number is P11140.

Abrin-a Protein, Abrus precatorius, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$19820 days20 days
10 μg$34220 days20 days
20 μg$57520 days20 days
50 μg$75520 days20 days
100 μg$92820 days20 days
200 μg$1,28020 days20 days
500 μg$1,97020 days20 days
1 mg$2,73020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Abrin-a Protein, Abrus precatorius, Recombinant is expressed in E. coli. The accession number is P11140.
Species
Abrus precatorius
Expression System
E. coli
TagTag Free
Accession NumberP11140
Synonyms
Abrin-a
Amino Acid
QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN
Construction
1-251 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight28.2 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 434 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords