Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Caspase-1 Protein, Human, Recombinant (HA)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01055

Caspase-1 Protein, Human, Recombinant (HA) is expressed in E. coli expression system with C-HA tag. The predicted molecular weight is 11.4 kDa and the accession number is P29466.

Caspase-1 Protein, Human, Recombinant (HA)

Caspase-1 Protein, Human, Recombinant (HA)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01055
Caspase-1 Protein, Human, Recombinant (HA) is expressed in E. coli expression system with C-HA tag. The predicted molecular weight is 11.4 kDa and the accession number is P29466.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12320 days20 days
10 μg$19720 days20 days
20 μg$336-In Stock
50 μg$49320 days20 days
100 μg$69020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Caspase-1 Protein, Human, Recombinant (HA) is expressed in E. coli expression system with C-HA tag. The predicted molecular weight is 11.4 kDa and the accession number is P29466.
Species
Human
Expression System
E. coli
TagC-HA
Accession NumberP29466
Synonyms
p45,Interleukin-1 beta-converting enzyme (ICE;IL-1 beta-converting enzyme),Interleukin-1 beta convertase (IL-1BC),IL1BCE,IL1BC,Caspase-1,CASP-1,CASP1
Amino Acid
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSA
Construction
1-91 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Caspase-1 Protein, Human, Recombinant (HA)
Molecular Weight11.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides. Plays a key role in cell immunity as an inflammatory response initiator: once activated through formation of an inflammasome complex, it initiates a proinflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes. Cleaves a tetrapeptide after an Asp residue at position P1. Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD. In contrast to cleavage of interleukins IL1B and IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive. In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly.; Apoptosis inactive.; Apoptosis inactive.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords