Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

FAM174A Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPZ-00003

FAM174A Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 10.34 kDa and the accession number is Q8TBP5.

FAM174A Protein, Human, Recombinant (His)

FAM174A Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPZ-00003
FAM174A Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 10.34 kDa and the accession number is Q8TBP5.
Pack SizePriceAvailabilityQuantity
Bulk & Custom
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
FAM174A Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 10.34 kDa and the accession number is Q8TBP5.
Species
Human
Expression System
HEK295 Cells
TagN-His
Accession NumberQ8TBP5
Synonyms
Transmembrane protein 157,TMEM157,NS5ATP6,FAM174A
Amino Acid
LAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQR
Construction
A DNA sequence encoding the human FAM174A (30Leu - 123Arg) was expressed with a polyhistidine tag at the N-terminus.
Protein Purity
> 90 % as determined by SDS-PAGE.
Molecular Weight10.34 kDa (Predicted)
Endotoxin< 1.0 EU per μg protein as determined by the LAL method.
FormulationSupplied as sterile solution in PBS, pH 7.4.
Stability & Storage
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
ShippingShipping with dry-ice

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords