Shopping Cart
- Remove All
 Your shopping cart is currently empty Your shopping cart is currently empty
Oleosin L Protein, Sesamum indicum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q9XHP2.

| Pack Size | Price | Availability | Quantity | 
|---|---|---|---|
| 5 μg | $588 | 20 days | |
| 10 μg | $992 | 20 days | |
| 20 μg | $1,680 | 20 days | |
| 50 μg | $2,230 | 20 days | |
| 100 μg | $2,800 | 20 days | 
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. | 
| Description | Oleosin L Protein, Sesamum indicum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q9XHP2. | 
| Species | Sesamum indicum | 
| Expression System | in vitro E. coli expression system | 
| Tag | N-10xHis | 
| Accession Number | Q9XHP2 | 
| Synonyms | Oleosin L,Oleosin 15 kDa,Allergen Ses i 5 | 
| Amino Acid | MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS | 
| Construction | 1-145 aa | 
| Protein Purity | > 90% as determined by SDS-PAGE. | 
| Molecular Weight | 16.7 kDa (Predicted) | 
| Endotoxin | Not tested. | 
| Formulation | Lyophilized from PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4 | 
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. | 
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 38 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. | 
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. | 

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.