Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Oleosin L Protein, Sesamum indicum, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04401 Copy Product Info
Oleosin L Protein, Sesamum indicum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q9XHP2.

Oleosin L Protein, Sesamum indicum, Recombinant (His)

Catalog No. TMPH-04401
Copy Product Info
TargetMol | SPR

Oleosin L Protein, Sesamum indicum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q9XHP2.

Oleosin L Protein, Sesamum indicum, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$58820 days20 days
10 μg$99220 days20 days
20 μg$1,68020 days20 days
50 μg$2,23020 days20 days
100 μg$2,80020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Oleosin L Protein, Sesamum indicum, Recombinant (His) is expressed in in vitro E. coli expression system. The accession number is Q9XHP2.
Species
Sesamum indicum
Expression System
in vitro E. coli expression system
TagN-10xHis
Accession NumberQ9XHP2
Synonyms
Oleosin L,Oleosin 15 kDa,Allergen Ses i 5
Amino Acid
MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS
Construction
1-145 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight16.7 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 38 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.