Shopping Cart
Remove All
Your shopping cart is currently empty
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32-amino acid polypeptide hormone synthesized by ventricular cardiomyocytes in response to myocardial cell stretching (cardiomyocyte distension)[1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $332 | Inquiry | Inquiry | |
| 5 mg | $828 | Inquiry | Inquiry | |
| 10 mg | $1,240 | Inquiry | Inquiry |
| Description | Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32-amino acid polypeptide hormone synthesized by ventricular cardiomyocytes in response to myocardial cell stretching (cardiomyocyte distension)[1]. |
| In vitro | B-type natriuretic peptide (BNP) mitigates cardiac stress by lowering blood pressure and decreasing ventricular fibrosis. Its variant, rat BNP BNP (1-32) (rBNP (1-32)), is a shorter version of the 45-residue natural rat BNP. Similarly, atrial natriuretic peptide-(1-28) (ANP), brain natriuretic peptide-(1-32) (BNP), and C-Type natriuretic polypeptide (CNP) are found in the brain, particularly concentrated in the anteroventral area of the third cerebral ventricle, and play a crucial role in regulating body fluid balance. These peptides, ANP(1-28), BNP (1-32), and CNP(1-32), operate in the mammalian brain to maintain salt and water balance through their engagement with receptors NPR-A and NPR-B. |
| In vivo | Comparative analysis of the effects of various brain natriuretic peptide (BNP) species versus atrial natriuretic peptide (ANP) 99-126 on depressor, natriuretic, and cyclic GMP responses has been conducted in conscious spontaneously hypertensive rats (SHR) and vehicle-treated or SQ 28603-treated conscious cynomolgus monkeys. In SHRs, the responses to 3 nmol/kg intravenous rat BNP (1-32) were found to be greater than those to rat ANP 99-126 and pig BNP-26, and were significantly enhanced by 100 mumol/kg intravenous SQ 28,603. Human BNP-32 showed no activity in SHRs treated with either vehicle or SQ 28,603. Conversely, in monkeys, 1 nmol/kg intravenous human BNP (1-32) induced renal and depressor responses that matched or surpassed those triggered by human ANP 99-126. Additionally, 3 nmol/kg intravenous rat BNP (1-32) reduced mean arterial pressure without impacting renal function. |
| Relative Density. | no data available |
| Sequence | Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26) |
| Sequence Short | NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.