Your shopping cart is currently empty

Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32-amino acid polypeptide hormone synthesized by ventricular cardiomyocytes in response to myocardial cell stretching (cardiomyocyte distension)[1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $332 | Inquiry | Inquiry | |
| 5 mg | $828 | Inquiry | Inquiry | |
| 10 mg | $1,240 | Inquiry | Inquiry |
| Description | Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32-amino acid polypeptide hormone synthesized by ventricular cardiomyocytes in response to myocardial cell stretching (cardiomyocyte distension)[1]. |
| In vitro | B-type natriuretic peptide (BNP) mitigates cardiac stress by lowering blood pressure and decreasing ventricular fibrosis. Its variant, rat BNP BNP (1-32) (rBNP (1-32)), is a shorter version of the 45-residue natural rat BNP. Similarly, atrial natriuretic peptide-(1-28) (ANP), brain natriuretic peptide-(1-32) (BNP), and C-Type natriuretic polypeptide (CNP) are found in the brain, particularly concentrated in the anteroventral area of the third cerebral ventricle, and play a crucial role in regulating body fluid balance. These peptides, ANP(1-28), BNP (1-32), and CNP(1-32), operate in the mammalian brain to maintain salt and water balance through their engagement with receptors NPR-A and NPR-B. |
| In vivo | Comparative analysis of the effects of various brain natriuretic peptide (BNP) species versus atrial natriuretic peptide (ANP) 99-126 on depressor, natriuretic, and cyclic GMP responses has been conducted in conscious spontaneously hypertensive rats (SHR) and vehicle-treated or SQ 28603-treated conscious cynomolgus monkeys. In SHRs, the responses to 3 nmol/kg intravenous rat BNP (1-32) were found to be greater than those to rat ANP 99-126 and pig BNP-26, and were significantly enhanced by 100 mumol/kg intravenous SQ 28,603. Human BNP-32 showed no activity in SHRs treated with either vehicle or SQ 28,603. Conversely, in monkeys, 1 nmol/kg intravenous human BNP (1-32) induced renal and depressor responses that matched or surpassed those triggered by human ANP 99-126. Additionally, 3 nmol/kg intravenous rat BNP (1-32) reduced mean arterial pressure without impacting renal function. |
| Relative Density. | no data available |
| Sequence | Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26) |
| Sequence Short | NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.