key

Dexamethasone acetate (NSC 39471) is the acetate salt form of Dexamethasone, a synthetic adrenal corticosteroid with potent anti-inflammatory properties. In addition to binding to specific nuclear steroid receptors, dexamethasone also interferes with NF-kB activation and apoptotic pathways. This agent lacks the salt-retaining properties of other related adrenal hormones.

Parkeyl acetate is a bioactive chemical.

Cyclic MKEY TFA, a synthetic cyclic peptide, inhibits CXCL4-CCL5 heterodimer formation, thus guarding against atherosclerosis and aortic aneurysm by mitigating inflammation. Additionally, it affords protection against stroke-induced brain injury in mice [1] [2].

Anti-Monkey/Human CD40L/CD154 Antibody (5C8) is an IgG2a inhibitor derived from mice that targets CD40L/CD154 in monkeys and humans.

Anti-Mouse/Human/Rat/Monkey/Hamster/Canine/Bovine TGF-β Antibody (1D11.16.8) is an IgG antibody inhibitor targeting TGF-β in multiple species including mouse, human, rabbit, monkey, hamster, dog, and cow. For information on the isotype control, refer to Mouse IgG1 kappa, Isotype Control.

Anti-Monkey/Human MHC class II (HLA-DR) Antibody (L243) is an IgG2a, κ antibody inhibitor derived from mice that targets monkey or human MHC class II.

Rat IgG2b isotype control, Anti-keyhole limpet hemocyanin is rat IgG2b isotype control, anti-keyhole limpet hemocyanin.

MKEY, a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, has been shown to protect against atherosclerosis and aortic aneurysm formation by mediating inflammation, but whether it modulates neuroinflammation and brain injury has not

GLP-1 (7-36), amide, chicken, common turkey is a polypeptide molecule with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2.

Keyhole Limpet Hemocyanin-FITC can induce both T cell-dependent and non-T cell-dependent immune responses.

Type II Collagen ( from Monkey) is a T cell-dependent antigen with unique immunological characteristics, used as a stimulating antigen in in vitro culture systems.

MacConkey Agar (MAC) is used for the selective isolation of enteric pathogens. The composition for 1 liter of MacConkey Agar includes: peptone (20.0 g), lactose (10.0 g), bile salts No. 3 (1.5 g), sodium chloride (5.0 g), neutral red (0.03 g), crystal violet (0.001 g), and agar (15.0 g).

1-PeCSO is isolated from onion or garlic bulbs. It acts as a key compound in garlic greening and reacts with lachrymatory factor synthase.

L-Cystathionine (Cystathionine, L-) is a key nonprotein amino acid related to metabolic conditions of sulfur-containing amino acids. L-Cystathionine can be used in studies about cardiovascular protection.

MU1656 is a potent and selective inhibitor of histone methyltransferase DOT1L (IC50 = 2 nM), a key epigenetic regulatory protein involved in the development of cancers such as hematologic malignancies, thus MU1656 was able to significantly inhibit the proliferation of cancer cells and induce apoptosis.

LKM38, a novel diazolidinyl cholesterol probe, is a promising cholesterol mimetic.LKM38 both maintains cholesterol-resistant cell growth and appropriately regulates key cholesterol homeostatic pathways.LKM38 can be a powerful tool for studying cholesterol protein interactions and trafficking.

Navamepent (RX-10045) is an analog of resolvin E1 (a dietary-3 polyunsaturated fatty acid metabolite), which has potent anti-inflammatory activity that reduces corneal inflammation, epithelial damage, and accelerates corneal tissue repair.Navamepent inhibits the release of several key pro-inflammatory mediators from corneal epithelial cells.Navamepent is very effective against dry eye and cupping cell loss Navamepent is effective against dry eye and cupping cell loss, and accelerates tear production.

2-Acetyl-6-methoxynaphthalene, the key intermediate of naphthalene tome and naproxen, is used in synthetic non-steroidal anti-inflammatory analgesic medicine and.

Cholesterol is the primary sterol in mammals, accounting for approximately 20–25% of the plasma membrane structure. It plays a key role in regulating membrane fluidity, permeability, and protein function. As an endogenous agonist of estrogen-related receptor α (ERRα), cholesterol is widely involved in metabolic regulation and serves as a precursor for the synthesis of hormones and bile acids. It is commonly used in experimental models of hyperlipidemia.

Rofecoxib (MK 966) binds to and inhibits the enzyme cyclooxygenase-2 (COX-2), resulting in an inhibition of the conversion of arachidonic acid to prostaglandins. Rofecoxib is a synthetic, nonsteroidal derivative of phenyl-furanone with anti-inflammatory, antipyretic and analgesic properties and potential antineoplastic properties. COX-related metabolic pathways may represent key regulators of cell proliferation and neo-angiogenesis. Some epithelial tumor cell types overexpress pro-angiogenic COX-2.

Methyl 3,4-dihydroxybenzoate (Protocatechuic acid methyl ester), a key metabolite of antioxidant polyphenols in green tea, exhibits significant antioxidant and anti-inflammatory properties.

Liranaftate (Piritetrate) is a thiocarbamate and squalene epoxidase inhibitor with antifungal activity. Liranaftate inhibits fungal squalene epoxidase, an enzyme that plays a key role in the synthesis of sterol which is essential for cell membrane integrity. By preventing ergosterol synthesis and causing accumulation of squalene, this agent increases cell membrane permeability, cell leakage and eventually cell lysis.

Benzylideneaniline (N-Benzylideneaniline) is a potent inhibitor of xyloglucan-α,β-dioxygenase, a key enzyme in the oxidative cleavage of the central double bond of xyloglucan.

Monomethylaniline is used predominantly as a key synthetic intermediate in the industrial manufacture of dyes, agrochemicals, and other organic products; Monomethylaniline also serves specialized functions as a latent and coupling solvent, as a component in octane boosters for gasoline, Monomethylaniline it can also be used in the development of advanced materials like electrodeposited coatings.