key

Dexamethasone acetate (NSC 39471) is the acetate salt form of Dexamethasone, a synthetic adrenal corticosteroid with potent anti-inflammatory properties. In addition to binding to specific nuclear steroid receptors, dexamethasone also interferes with NF-kB activation and apoptotic pathways. This agent lacks the salt-retaining properties of other related adrenal hormones.

Parkeyl acetate is a bioactive chemical.

Cyclic MKEY TFA, a synthetic cyclic peptide, inhibits CXCL4-CCL5 heterodimer formation, thus guarding against atherosclerosis and aortic aneurysm by mitigating inflammation. Additionally, it affords protection against stroke-induced brain injury in mice [1] [2].

Anti-Mouse/Rat/Monkey/Human ICOS/CD278 Antibody (C398.4A) is an IgG antibody inhibitor derived from American hamster, targeting ICOS/CD278 in mice, rats, monkeys, and humans.

Anti-Monkey/Human MDR-1/CD243 Antibody (UIC2) is an IgG2a, κ monoclonal antibody derived from mice, designed to inhibit MDR-1/CD243 proteins in monkeys or humans.

Anti-Monkey/Human CD28 Antibody (CD28.2) is a mouse-derived inhibitory antibody targeting monkey/human CD28.Anti-Monkey/Human CD28 Antibody (CD28.2) blocks CD28 signaling and is suitable for immunological research.

Anti-Monkey/Human CD20 Antibody (2H7) is a mouse-derived antibody that specifically targets the CD20 antigen in monkeys and humans and exerts an inhibitory effect. It achieves selective depletion of B cells through its targeting action and is commonly used in research on inflammatory and metabolic diseases such as diabetes and experimental autoimmune encephalomyelitis (EAE).

Anti-Human/Monkey CD16a Antibody (3G8) is a monoclonal antibody targeting human and monkey CD16a and can be used in immunological research.

Anti-Human/Mouse/Monkey PD-1 Antibody (2E5) is a monoclonal antibody targeting human, mouse and monkey PD-1 and can be used in cancer immunotherapy research.

Anti-Human/Mouse/Monkey CXCR3 Antibody（9C5) is a monoclonal antibody targeting human, mouse and monkey CXCR3 and can be used in immunological research.

Anti-Human/Monkey/Canine IL-17A Antibody (Mab7) is a monoclonal antibody targeting human, monkey and canine IL-17A and can be used in inflammation research.

Anti-Human/Mouse/Rat/Monkey/Canine/Rabbit IL-1b Antibody (AB7) is a monoclonal antibody targeting human, mouse, rat, monkey, canine and rabbit IL-1β and can be used in inflammation research.

Anti-Human/Monkey NKG2D Antibody (16F16) is a monoclonal antibody targeting human and monkey NKG2D and can be used in cancer immunotherapy research.

Anti-Human/Monkey NKG2D Antibody (ON72) is a monoclonal antibody targeting human and monkey NKG2D and can be used in cancer immunotherapy research.

Anti-Human/Mouse/Monkey CLDN18.2 Antibody（25C7A5-HZ1） is a monoclonal antibody targeting human, mouse and monkey CLDN18.2 and can be used in cancer research.

Anti-Human/Mouse/Monkey TL1A Antibody（1D1） is a monoclonal antibody targeting human, mouse and monkey TL1A and can be used in inflammation research.

Anti-Human/Monkey CD28 Antibody (2D8.S) is a monoclonal antibody targeting human and monkey CD28. It can be used for T-cell costimulation research.

Anti-Monkey/Human CD40L/CD154 Antibody (5C8) is an IgG2a inhibitor derived from mice that targets CD40L/CD154 in monkeys and humans.

Anti-Mouse/Human/Rat/Monkey/Hamster/Canine/Bovine TGF-β Antibody (1D11.16.8) is an IgG antibody inhibitor targeting TGF-β in multiple species including mouse, human, rabbit, monkey, hamster, dog, and cow. For information on the isotype control, refer to Mouse IgG1 kappa, Isotype Control.

Anti-Monkey/Human MHC class II (HLA-DR) Antibody (L243) is an IgG2a, κ antibody inhibitor derived from mice that targets monkey or human MHC class II.

MKEY, a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, has been shown to protect against atherosclerosis and aortic aneurysm formation by mediating inflammation, but whether it modulates neuroinflammation and brain injury has not

GLP-1 (7-36), amide, chicken, common turkey is a polypeptide molecule with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2.

Keyhole Limpet Hemocyanin-FITC can induce both T cell-dependent and non-T cell-dependent immune responses.

Type II Collagen ( from Monkey) is a T cell-dependent antigen with unique immunological characteristics, used as a stimulating antigen in in vitro culture systems.